(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE57

ASHGO_7.PE57         Location/Qualifiers
FT   CDS_pept        complement(116107..116802)
FT                   /codon_start=1
FT                   /gene_family="HOG000182400" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622194"
FT                   /locus_tag="AGL314C"
FT                   /orf_name="AGOS_AGL314C"
FT                   /product="AGL314Cp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54177.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG020768"
FT                   /db_xref="HOGENOM:HBG436319"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniParc:UPI0000253328"
FT                   /db_xref="UniProtKB/TrEMBL:Q751L5"
FT                   /transl_table=1
FT                   /translation="MACCPDSVTPLESSPEVFTDFAHALGLQSDMAFHDIYSLTDPDML
FT                   AFLSRPMKSVILLFPLNAFFRELICPEYHGGDKSPIWFKQTIRNACGMYALLHSLANNR
FT                   ELVMQDSPLDRFLAQNPSADGRYDDQNTVDFLVANGELYQRSSLQGQTEAPDPEEEVEL
FT                   HFITFLVSGGQVFELDGRGKGPYLLGAASDGDVLEQPLVKDRIQWFMDNADDEAKNQFS
FT                   LLGLGPSWK"
     atggcctgtt gtcccgactc cgtgactcca ctggagtcca gccctgaggt ttttaccgat        60
     tttgcccatg ctcttgggct acagtctgat atggcattcc acgacatata ctcattgact       120
     gaccctgata tgttggcttt cttgtctagg ccgatgaagt ccgtgattct cctattcccg       180
     ctgaacgcct tctttagaga actaatttgc ccagagtacc acggcggaga taagtcgcca       240
     atatggttta agcaaaccat caggaacgca tgcgggatgt atgctcttct tcattcgctg       300
     gccaacaaca gggagctcgt gatgcaggat tctccactgg acaggtttct ggcgcagaat       360
     ccgtcagctg acgggaggta cgatgaccaa aacaccgtgg acttcctggt ggctaacggg       420
     gagctatacc agaggagctc gctccagggg cagacggagg caccagaccc ggaggaagag       480
     gtggaattgc acttcatcac gttcctagtt agtggcggtc aggtgttcga acttgacgga       540
     cgcgggaagg ggccgtacct gctgggcgcg gcctctgacg gagacgtcct ggaacagccg       600
     ctggtcaagg accgtataca atggtttatg gacaatgcag atgacgaggc caagaaccaa       660
     ttttcacttc taggcttggg tccgtcgtgg aaataa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page