(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE73

ASHGO_7.PE73         Location/Qualifiers
FT   CDS_pept        complement(146168..149515)
FT                   /codon_start=1
FT                   /gene_family="HOG000246583" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774756"
FT                   /locus_tag="AGOS_AGL298C"
FT                   /product="AGL298Cp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="AAS54193.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG056650"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI0001DB2AE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K4"
FT                   /transl_table=1
FT                   /translation="MDQAFVAQLEQTLAAIVSPNASSLKETTKTLQTQFYTQVTALPAL
FT                   VHIMQNSGDDALKQLAGVEARKLVAKHWGKLDGALKTEIKSTLLQTAFTEPKDMVRHSS
FT                   ARVIAAIGSEDLSDDQWPDLVPNLLRAAADENPKTRETSVFVLLSLLESYNDALGKYIA
FT                   EFLTLFSQTINDSASLETRSLSVQALNHVSALIEEQEKINPEHANQFAALIPSVVQVLD
FT                   AVIKADDNVNTKLIFNCLNDFLLLDSQLTGNAVVDLIKLALQIAGNVQVDEEVRVFAVQ
FT                   FVISAVSYRKSKIQQAKLAPEITITALKVASDQVDVEDELNTEEEAGENEENTPCLTAM
FT                   RLIAFCSTEFPPSQVAAPIMEHLPAMLSSANQFERRAILLAISVAVTGSPDYMLSQLDR
FT                   IIPATISGMKDQEPIVQLAALKAVSQLTTELQDEVAKFHEEYLPLIISIIDNSKHVVIY
FT                   RYATTALDGLLEFIAYDAIAKYLEPLMNKLFQMLESQTSSKLRAAIVSAIGSAAFAAGS
FT                   NFVPYFKTSVQFLEQFIQNCSNIEGMSEDDIELRALTFENISTMGRAVRSTTFAEVAEP
FT                   LVNSAYEAIKTDSARLRESGYAFIANMAKVYGKDFAPFLETIMPEIFKTLQQEEYQFNF
FT                   DGDADDLAAFADDADEDDLQNKFTVNTGISYEKEVAAAALSELAIACKEQFLKFVEPSL
FT                   KVLREQVDESYGLRETAMHTIWNIVKAVLLTTNINEDNYPKGVPTGSYVDSSVLSVIQT
FT                   AREISLDGLSEEFETSMIITVFETMAEMIKKFGPIIIMDNGDSTYLEQLCLQVLSVLKG
FT                   EHTCQTIDYEDDVPKDEDMDASETEAALLDVALEVLVSLSHALADGYPKVFEGFKPIVL
FT                   SLFETKSKNKRSAAVGAVSEIALGLKEHNPYVQELLQAMIIRLTADKSLEVRGNAAYGV
FT                   GLLIQYAQFDVSAVYEPVLKAMYQLLNTADQKVLTANDDEATKEIIDRAFANATGCVAR
FT                   MTLRSENLVPLEHTLPALLSHLPLNTGYEEYDPIFELIIKLYQANNSLIIAETPRIIEF
FT                   FAAVFTKDNERIQLEKESTLGREENMDKLKQFQSQEMRQRVVELLKFLNQTYNGIVAQN
FT                   AVLAPVIA"
     atggaccaag cctttgtcgc gcagttggag caaacgctgg ctgcgattgt cagccccaac        60
     gcctcctctt tgaaggagac gacgaagacg ctgcagacac agttctacac acaggtgaca       120
     gcgttgcctg cgctcgttca catcatgcag aacagcggcg acgacgcatt gaagcagctt       180
     gccggtgtgg aggccagaaa gctggtagcg aagcactggg gcaagctaga cggcgcgcta       240
     aagactgaaa taaagagcac tttgctgcaa acggcgttca ccgagcccaa ggacatggtc       300
     cgccactcca gtgcgcgtgt gatcgctgca attggctcag aagatctatc cgacgaccag       360
     tggccggacc tagttccaaa cctgctacgt gcggcagcgg acgaaaaccc taagacaagg       420
     gagacgtctg tctttgtgtt actctctcta ctagagtcct acaatgatgc tctagggaaa       480
     tacattgccg agttcttgac tttgttttcg cagaccatca acgattccgc gtccttggag       540
     acgaggtctt tgtctgtcca ggctttgaac catgtttctg ctttgattga ggagcaggag       600
     aaaattaacc ctgagcatgc gaatcaattt gccgctctaa ttccatccgt cgtccaagtc       660
     ttggatgctg tgatcaaggc tgatgacaac gtgaacacta agttgatttt caactgtcta       720
     aatgacttct tgttgttgga ctcgcagctc acgggcaatg ccgtcgtcga tttgatcaag       780
     ctagccctac agattgcggg taatgttcaa gttgatgaag aggttagagt ctttgccgtc       840
     cagtttgtca tttctgctgt ctcttataga aagtcaaaga tccaacaagc taagttggct       900
     cctgagatca cgatcaccgc attgaaggtt gcatctgacc aagtcgatgt agaggacgag       960
     ctaaacaccg aggaagaagc gggggagaac gaagagaaca ctccttgttt gaccgcgatg      1020
     agattgattg ccttctgctc aactgaattc ccaccttccc aggttgctgc gcctattatg      1080
     gagcacctac cagcgatgct ttcttctgcc aatcagtttg agagacgtgc tatcttgttg      1140
     gctatatctg ttgctgtcac aggttcccct gactacatgc tctcccaact ggacagaata      1200
     attcctgcta ctatcagtgg tatgaaagac caggagccaa tcgttcaact cgcagcgcta      1260
     aaggcggtgt cgcagttgac aactgagctt caggacgaag tcgccaagtt ccatgaagaa      1320
     tatctgccac taataatcag tatcattgac aactccaagc acgtcgttat ttacagatat      1380
     gccactacag cccttgatgg tctgctagag tttattgctt atgatgctat tgcgaagtat      1440
     ctagagccac taatgaacaa gcttttccag atgttggaat ctcagacctc ttccaagttg      1500
     agggcggcta tcgtctcggc gattggttct gctgcctttg ctgcgggctc taactttgtg      1560
     ccatatttca agacctctgt tcaattcttg gagcaattca tccagaactg ttctaacatt      1620
     gagggtatgt ctgaggacga cattgaactg agagctttga catttgagaa tatctctact      1680
     atgggtagag ccgttagatc tactactttc gcagaggttg cggagccgct tgtgaactct      1740
     gcttacgaag ccatcaagac cgactctgct agattgagag agtctgggta tgctttcatt      1800
     gccaacatgg ccaaggtcta cggcaaggac ttcgctccat ttttggaaac tattatgcca      1860
     gagatcttca agactttgca gcaagaggag taccaattta acttcgatgg cgatgctgac      1920
     gatctagcgg cttttgcgga tgatgctgac gaggacgacc tgcagaataa gttcaccgtc      1980
     aacacaggta tctcctacga gaaggaagtt gcagctgccg ctttgtccga gctcgccatt      2040
     gcctgcaagg aacagttctt gaagtttgtc gagccatcct tgaaagtatt gagagagcag      2100
     gtggacgaat cgtacgggtt gagagaaact gccatgcaca ccatttggaa cattgtcaag      2160
     gctgtcctgt tgacgactaa catcaacgag gacaactatc caaagggcgt tcctaccggc      2220
     tcctacgtgg acagcagtgt cctatccgtt atccaaactg ccagagagat ctccttagat      2280
     ggtttgagtg aggagtttga gacttctatg atcatcaccg tctttgagac gatggctgaa      2340
     atgatcaaga agttcggtcc aatcatcatt atggacaatg gtgactccac atatttggag      2400
     cagttgtgct tgcaagtttt aagcgtacta aagggcgagc acacttgcca gaccattgac      2460
     tacgaggacg acgtgcccaa ggatgaagat atggatgcct ctgagaccga agcagcgttg      2520
     ctagacgtcg cattggaggt gttggtgtct ctatcccatg ccctagccga cggatatcca      2580
     aaggtttttg agggcttcaa accaatagta ctatccttgt ttgaaacaaa atcgaagaat      2640
     aagagatctg ctgctgtcgg tgcagtttcg gaaattgcgt taggcttgaa ggaacacaac      2700
     ccatatgtcc aggaactgct tcaggcgatg attatcagat tgactgcaga caagtctctc      2760
     gaggtgcgcg gtaacgcggc ctacggtgtg ggtctattga tccagtacgc acagtttgac      2820
     gtgtctgctg tatacgagcc tgtactaaag gctatgtacc agctgttgaa caccgctgac      2880
     caaaaggtcc ttactgccaa cgacgatgag gctaccaagg agatcatcga ccgcgccttc      2940
     gctaacgcca cgggctgcgt tgccagaatg acgctaagaa gcgaaaacct agttcctctg      3000
     gagcacactc ttccagcgct attgtctcac ctacctttga ataccgggta cgaggaatac      3060
     gacccgatct ttgagttgat catcaagctc taccaggcta acaacagtct catcattgca      3120
     gaaactccta gaattatcga gttcttcgcc gccgtgttca ccaaggacaa cgagagaatt      3180
     cagctggaga aggaatcgac cttgggcaga gaggagaaca tggataaact aaagcagttc      3240
     cagtcccagg agatgagaca aagagtggtc gaacttttga agttcttgaa ccaaacctac      3300
     aatggcattg tggcccagaa tgctgttctg gctcccgtta tcgcctga                   3348
//

If you have problems or comments...

PBIL Back to PBIL home page