(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE74

ASHGO_7.PE74         Location/Qualifiers
FT   CDS_pept        complement(150249..153161)
FT                   /codon_start=1
FT                   /gene_family="HOG000141812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19774757"
FT                   /locus_tag="AGL297C"
FT                   /orf_name="AGOS_AGL297C"
FT                   /product="AGL297Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS54194.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG060088"
FT                   /db_xref="HOGENOM:HBG203685"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000253339"
FT                   /db_xref="UniProtKB/TrEMBL:Q751K3"
FT                   /transl_table=1
FT                   /translation="MGMSSAPTGVSNGGSTIPIIEIATYAGVDVYECYCRGKESSIVMR
FT                   RLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQGTWIPLDSAKGL
FT                   VAKYEITDIVVLTVINFQPDPMNMPPRRSKNSIIKKLSPATRITSPSSYNKTPKKKVSE
FT                   LANQSTTGSVSKKTRKRAGAKAAQPSPLQNLVFQTPQQQHRNSQQQTNYTIVGHDQETP
FT                   INSIMVVETTSSMQKRTHRRSASSVMLLPPAPSNKKPEASLPPAPATSSSSKQHRYAAT
FT                   QKPLQFYPFPVPTSTSNNIQDIHIISENPNQKHKTKKSANKPKSKQGAQVVQTPAQTKK
FT                   PPPGKANPKMSSFTILPPITAIHKTSTSSGSNTSHGSSIDCYSSNDNPTPISSRSGSPQ
FT                   SKETFTPSEYKNLILQVLSTEYDSCEPVLPEKMYYPPIGLDVNFIIDKQGHTSLHWAAA
FT                   MANIPLIKILLTLEADIFHCNDKGFNCITKSIFYNNCYRTGAFFLIVELLRMCLVTPDA
FT                   NGRLPLHYLVELSVNKSKDPLVTNYYIDTILDVLSKDDPSVLKMCLNYQDSIGNTVLHL
FT                   AALNMNLALSNKLYYMGSSMEILNSHQQTPASILSKASMTQPIPNVINTPMPTMMPTPM
FT                   TAPISANTGQVSFRKKQSKLNTPLRPRKSNKDDIISATRHKVQLCETTFTETPQNPTVV
FT                   TSATHSTSMPEPSSELAKTPSHHEKLFALDRIAELNSTPVLKVTTPGGTAMKELSVPAA
FT                   SQETISEHRYSVAVDPLMQIQKSTRLTFPNVANTAQEFSELSQSLTEAIEQNFIKLGTE
FT                   IAKATEGIEGIDRSLKFSEKQVADILVKHGVTDTEQLKHKIHDEQNALQAQISRFANSI
FT                   EKSQALTLATLVHDEEEKADADSSHEQSTEGAKQLFRLGLELSLLQLKRKHIIDKVCRA
FT                   KTTINSGTKIYKYRKLIGISSDDIESKLNDIENDLRGAVA"
     atgggcatga gcagcgcgcc gacaggagtg tcgaatggcg gctcgaccat tccgatcata        60
     gaaatcgcga cctatgcggg cgtggacgtg tacgagtgct actgccgggg taaggagtcg       120
     agcatcgtga tgcggcgtct gcacgacgac tgggtgaaca tcacgcaggt gttcaaggtg       180
     gcgacgttct cgaagacgca acgaacgaag atcctagaga aggagtccgc agacatcagc       240
     cacgagaaaa tacaaggcgg ttacgggagg ttccagggca cctggatccc ccttgacagc       300
     gctaagggcc tcgtggcgaa gtacgagatt acggacatcg ttgtactgac ggtcataaac       360
     ttccaaccag atccgatgaa catgccgccg cggcgctcca agaattccat catcaagaag       420
     ctgtcaccag ctacgcgcat aacttcacct tccagctaca acaagacccc gaaaaagaag       480
     gtctcggaat tggcaaacca atcaacgaca ggttctgtat caaagaagac caggaaaaga       540
     gctggcgcca aagccgcgca gccttcgccg ctgcaaaacc ttgtgttcca aacaccgcag       600
     cagcagcacc gaaatagtca acaacaaacg aattatacaa tagtgggcca tgatcaagag       660
     acacccatta actctattat ggtggtggag acaacaagta gcatgcagaa gcgcactcac       720
     cggcgatcag cctctagcgt catgttactg ccaccagcac cctctaataa gaagcccgaa       780
     gcaagtcttc caccggcccc agccacctct tcgagtagta agcagcatcg ttatgctgcc       840
     actcagaaac cgcttcaatt ctatccattc cctgttccta cttctacctc caataacatt       900
     caagatattc acatcatctc agaaaaccca aatcaaaaac acaagacaaa gaagtctgct       960
     aataaaccta aaagtaaaca gggcgcccaa gtagtacaaa cgcctgctca aacaaagaaa      1020
     ccaccgcccg gaaaggccaa cccaaagatg tcaagtttta caatactacc gccaataaca      1080
     gctatccata aaacaagcac atctagtgga tctaacacat cgcatggctc ttctattgac      1140
     tgctattctt cgaatgataa ccccactcca atttcctcga ggtcaggctc gccacaaagt      1200
     aaggagacat ttactccctc cgagtataaa aatctgatat tacaggtgct gtccactgaa      1260
     tatgatagct gcgaaccagt attacccgag aagatgtact atccaccgat tggtctagat      1320
     gttaatttca tcattgataa gcagggacat acttccctac attgggcggc agctatggca      1380
     aacatcccgc tgattaagat actgctaaca ttggaggccg atatattcca ttgtaacgac      1440
     aagggcttca actgcattac caaaagtatc ttctataata actgttatag gacgggggcc      1500
     ttttttctga tagtagagct tctgcgaatg tgtctggtta cacccgatgc taatggcaga      1560
     ctaccattac attacctggt tgaattaagc gttaataaat ccaaagaccc gttagtcacc      1620
     aattattata ttgacactat cctcgacgtt ctgtcgaaag atgatccctc ggtgttaaag      1680
     atgtgtttga attatcagga tagcattggg aacacagttt tacatcttgc cgcgctaaac      1740
     atgaatttgg ctttgtcgaa taagctctac tatatgggga gctctatgga aattttaaat      1800
     tcacaccaac agacgccagc atccatcctt tccaaagcta gtatgaccca gcctatacca      1860
     aacgttatta acacaccaat gcccacgatg atgcctactc caatgacagc acctatatcc      1920
     gccaacacgg gacaggtgag tttccgcaaa aagcagtcta agttgaacac cccgttgagg      1980
     ccacgaaaga gcaataagga tgacatcatc agcgcaaccc gccataaggt tcagttatgt      2040
     gaaaccacat tcaccgagac accgcagaat ccaaccgtag ttactagcgc cactcattcc      2100
     acgagtatgc ctgaaccttc ttctgaatta gcaaaaacgc cctctcatca cgagaagctc      2160
     ttcgcgctgg acaggattgc tgaattaaac agtacgcccg tcctcaaggt aaccacgcca      2220
     ggaggtactg cgatgaagga actcagtgtg cccgcggcat cgcaagagac gatatcagaa      2280
     catcgatatt ctgtcgcagt agacccttta atgcagatac agaaatccac aagattgacg      2340
     ttcccaaacg tggcgaacac cgcccaggaa ttttcagaac tatcacaatc cctcacagag      2400
     gcaatagaac agaactttat taaactggga accgaaatcg cgaaggcgac cgagggcatc      2460
     gaaggcatcg atcggtcctt gaagttctca gagaagcaag ttgccgatat cctggttaaa      2520
     cacggagtta ccgacacaga gcagctcaaa cacaagatcc acgatgagca gaacgcgctg      2580
     caggcacaga tatcacgctt cgcaaactct atcgagaagt cgcaggccct gactctcgcc      2640
     accctagtgc acgacgaaga ggaaaaggct gacgccgata gctcccatga acagtctacc      2700
     gaaggcgcca agcaactctt ccgcctcggc ctcgaactat cgcttctcca actcaagcgc      2760
     aaacacatca tagacaaggt ttgcagggct aagacgacca tcaactccgg cacaaagata      2820
     tacaagtacc gcaagcttat aggcatctct tcggacgaca tagaatccaa actgaacgac      2880
     atcgagaacg atctgcgcgg agcagttgcc taa                                   2913
//

If you have problems or comments...

PBIL Back to PBIL home page