(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE84

ASHGO_7.PE84         Location/Qualifiers
FT   CDS_pept        168267..176573
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927769"
FT                   /gene_name="TEL1"
FT                   /locus_tag="AGL287W"
FT                   /product="Serine/threonine-protein kinase TEL1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54204.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG124834"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR015519"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021668"
FT                   /db_xref="UniParc:UPI0000253343"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751J3"
FT                   /transl_table=1
FT                   /translation="MEQYVASAINLLSSPKLKERSQALTDVAAIVKDNPDTLTSKSVGA
FT                   LVQSLIDILDAETRKFDELCRRRPEAGARVELAQGRLNSVVAVLRLVLETIPDRLRAKQ
FT                   FRGLVLSLPELLGWAIREQVHDMLQPLSACLQALTECHTFKLKVDDGQWRTLVRASAED
FT                   LVALFGINCTHKSIAKLAGALTSLIRMDAVGFKDVCEELLLIPVRYYQNTDKETANMRS
FT                   ILQLCNLLVLKGHLIKFHGVQYLIHCTMQHLLQFTLPGTDYILEEIAVFTLFSAELMIH
FT                   EVPYIPGDLESGRYFGKEVLSELYQQFIVHLLENYRPQKLQLKDLEYRLLLDRRQWYQL
FT                   DDFQISPHASHIEWLQLQGISNMLCSYYAFQHRHPVMDISQVKRRRLSDTYNSFLLNSQ
FT                   YGISFATSCIDSNPVSSQLLGLQLAACVTSFHECPKYQLEELLDAILRRFENANLVGWC
FT                   CLAMLPLCSQLDLVISETVLQKLLKLTLPLLKIPTLSAVASALISKLLDYQQRTLTGSN
FT                   MLQQCYDLYELSDIIGPAVVSNESFRLWQSLHIYGGDFRGKDGSSAADRIANWLFAKLN
FT                   TVSPLDESQNSFPHFLGWLAGCQLKDAYEVNRAIHVNSYCLEWEYTSVERTFLLSIETS
FT                   RRLSRNRTTPLQNMNYESSSISELFYRILDKITSQDDIEAYGWMCFGLQLIHHIRELTY
FT                   LVEYVNDLKKAICLRLGKMNFGNSQILLSCIRQTTSLPSCDILPLFFTEREIANIIYTY
FT                   KELKLTEVPEGPAEDDFAGPAKARHKLYPLNHLYAGKQGFEIDYVVSFIIMCSDYETNG
FT                   DAAEKVIELFLQLARSLPTNLIFQALPTLITYIGSNDRENISEDTLLALTEFTGSSLLT
FT                   NEYNTSTLSITYLSLFLKSISRYWLSDTHMPSLTADCNDILEWIFSRLGDSSCIGCEAI
FT                   MAILDMTLHMLKNYNRSNSKFTFDKQHLFHVLTTCLGRLPKFYICKVVHELNSYVVRLG
FT                   LKNQSIIFSEFAGLFDPPQRDAETAAYYSLTLAGLGTISHMHLSNAILHVLPNLQHKHV
FT                   SQYALSFLKSVAGFHKLSGIRALFHLCRFEILDIWSNKCAGLRDFSPIWNTAIFQFESF
FT                   EQFINEYKHEVAAYYFAKLSPYHYLKSTLVNDDKELPQLLEISLQYAIPLAYIPGGIGD
FT                   AIFDICADQWSATNHTNVLKQQYLLIFDRLLHFADLTVFMEYFESLQKVYTNSELIHKM
FT                   KKYTYNLHPKHLLSYSLRTALKVIHSKVLLGKLSIQELRFLLTLNLQYLQESTLPDDRS
FT                   QILRKIQIILVAYEQQLEDASSVSDLLEILTDYLDDPLLGNEVGALIGSIVALGFNVKY
FT                   TESLFLCIFAKLLPQLHEAKTANLSILLNDISNTLTINNSNIIHGKWWHACIDALAGTS
FT                   LFENTIYHDDSLLDTELLDHRALNLYSEILSFLPPFTGFPPNFVPKERVLRHLISQTTT
FT                   FKLHDNFLLWKGHYIGMYHKFHGTIPQLAPNGPNQKLSIDKLVKNYGLLNGIFELLEAI
FT                   EKTTHARIKFICQCINAVSLSHKDSLSTFTADTQQFFGQLSSKSVPLDLALFFYMFPIS
FT                   NPSESMETFCRLHYPALTSDYSSWLVKLTMFALDMLGRYIPVVKCFEVLATAITSRVEQ
FT                   LLNYWLLLLLYCDPNNGIRLLCTLISNIGLLKSTKEGILKIKYMLNLLLIVRSFHKLGY
FT                   KEFDTIYDRISLQDAYKVAAEVGEKYIACLLFEEFHMPNLARLDVTYMKEIYKQFDDVD
FT                   MIYGIPTTASLASAIELINQTQATSLKSFMMNNGNFDAQYATHFTGNIGNLVNSASNNG
FT                   FTGLAYALQNISSSKNTSATYNWCIELDKWDLPTPDILDSTAKSIYSIIKKTDINTGTA
FT                   EAAFKSTMLNALQFLEKTGVNEDNVSQLGSIVTMVQLYNNNAEKLVKSLHAQDRKILKV
FT                   KDFNDYYMDIKVRHVFLDHLIDSHKNRLSEEQSICLRFASICELSHLSEVARGASDFQR
FT                   SLDAVLLLEKSVLALPTNSSVEHYGLFKTFARRMSTIQSAKMLWSQNETVMSIDMLKDL
FT                   LHTPLSSNLIARARKQPFFQQMAILDINVKAQLVQWLSHSRQDVPERIFKNYIGTSLQD
FT                   IENYGDNPSRTEIVHTFGKFCYDQAKRFSETNEVDIMARRVSKNKEELAALYQLYHDRS
FT                   LPERERKEAKRHYARLLVRNQQETETYNQLRDQRELFVTNALLFFTQTLQYDDLYDGEV
FT                   IDQFCGLWFEYSNDDNVSGKLLSNLQNIPEYKLLPWINQMASKLADDESPFQKTLRAAM
FT                   VRILLKLPYDSLYVLIGMSLTGSRQNAKDSGSQSRLVAVESLLKEVSKHDYGSYATKYL
FT                   LPVREFCEMSVSLASQKFAQNTRKIHLNNLKIGTYWLKELKGRKLPLPTAQSRVSDRCG
FT                   NSVSRSYITQVDPDVRIASSGLSLPKIVTFTLSDGTRHRALLKAGNDDLRQDAIMEQVF
FT                   KQVNKILTSNKRTRKLKLRIRTYEVIPLGPQAGIIEFAPNSKSLHEILAGYHKDDTISL
FT                   EQARKAMKAVQGKSKEQRIAVYVKITESVKPVLRNFFYETFLDPEEWLLAKATYTKGVV
FT                   TNSIVGHILGLGDRHLNNILLDKFTGEPIHIDLGVAFDQGKLLPLPELVPFRLTRDIVD
FT                   GFGVMGVEGLFRKNCEKVYGLLRKERERVMCVLNVLKWDPLYSWKMTPLRRQKLQGKLV
FT                   DGDSPSDSLVTSLPDSSDNDESRRALKGVEDKLLGNGLSVEATVQELVHRATDVSNLAV
FT                   IFMGWSPFY"
     atggagcagt atgtggcgtc tgcgataaac ctgttgagtt ctccgaagct caaggagagg        60
     tcgcaggcac taacagatgt ggcggcgatc gtgaaggaca accctgacac tctaacaagc       120
     aaaagcgtcg gagcgctggt ccagagccta atagatatac tcgatgctga gacgcgaaag       180
     tttgacgagt tgtgccgacg gcggccggaa gctggcgcaa gggttgagct ggcgcagggc       240
     aggctgaact cagtggtcgc tgtgctccgg ctagttctcg agacgattcc ggaccggtta       300
     agggcaaaac aattcagagg gctcgtgctc agcttgccag aactgcttgg atgggcgatt       360
     cgggagcaag tacacgacat gctgcaaccg ctgtcggcgt gtttacaggc gctgaccgag       420
     tgtcacacgt tcaagctaaa agtggacgac ggccagtggc gcacgcttgt cagggcctcc       480
     gcagaggacc tggtagccct ttttggcatc aactgcacgc ataaatcaat tgccaagttg       540
     gcgggcgcgc ttacttcgct gatacggatg gatgccgttg ggttcaaaga tgtgtgtgaa       600
     gagctcctcc ttataccggt caggtactac cagaacacag acaaagagac tgccaacatg       660
     cgctcgattc ttcaactatg caacttactc gtgctcaaag gacatctgat caagtttcat       720
     ggtgtccagt acctaatcca ttgcacaatg cagcatctcc ttcagtttac tctgccgggc       780
     accgattaca ttttagaaga gattgcagtc ttcacgctct tcagcgctga gctgatgatc       840
     catgaagttc catacattcc tggagacttg gagtctggaa gatatttcgg gaaagaagtt       900
     ctgtctgagc tatatcagca gtttatcgtt catcttctgg agaattaccg ccctcaaaaa       960
     cttcagctaa aggatttgga ataccgattg ctacttgata ggcggcaatg gtaccaacta      1020
     gatgattttc agatctctcc acatgcgagt cacattgaat ggctgcaatt acagggcatc      1080
     tcgaatatgc tctgtagcta ttatgctttc caacaccggc atcctgtcat ggatatcagc      1140
     caagtgaaaa ggcgcaggct ttctgacact tacaactcct tcttgctcaa ttcacagtac      1200
     ggaataagct ttgccactag ctgcattgat agcaatccag tctccagtca gctactggga      1260
     ttacagttag ccgcgtgtgt cacgtccttc cacgaatgcc ccaagtatca gctagaggag      1320
     ctattagatg ctattttgcg tcgtttcgaa aatgccaacc tcgttggatg gtgttgcctt      1380
     gccatgcttc ccttatgctc tcagctcgat cttgttataa gtgagactgt tctgcaaaaa      1440
     ctactgaaac tcactctgcc cttgctaaag atacctacgt tatccgctgt tgcatccgcg      1500
     ctaatatcaa agttgctgga ttatcagcaa aggacactta cgggcagtaa catgttacaa      1560
     caatgctatg acctttacga actttctgac attatagggc cagcggttgt ctctaatgag      1620
     tctttccgtt tatggcaatc tttgcatatc tatggaggcg atttccgggg gaaggatgga      1680
     tcatctgcag cggatcgtat tgcgaattgg ctatttgcca agttaaacac cgtctcccct      1740
     ctggatgaat cacaaaatag ctttccgcac tttctgggat ggcttgctgg atgccaattg      1800
     aaggacgctt atgaagttaa tcgagcaatc cacgttaaca gttattgctt ggagtgggaa      1860
     tacacttcag tcgaaagaac atttctactt tctattgaaa catctaggag attatctcgg      1920
     aatagaacga ccccacttca gaacatgaac tatgaatcga gctcgatttc tgaactattc      1980
     taccggattc ttgataaaat aacaagccaa gacgatatcg aagcatatgg atggatgtgc      2040
     tttggtctac aattaatcca tcatattaga gaattgactt atctcgtgga gtatgtcaac      2100
     gatcttaaaa aggcgatctg cctgcggctg gggaaaatga attttggtaa tagtcagatt      2160
     ttactttcgt gtataaggca aacgacctcc ttaccttctt gtgatatatt gcctttgttt      2220
     tttactgaga gagaaattgc caatatcatt tacacctaca aggagctgaa gctgacagag      2280
     gtaccggagg gtcccgcaga agatgatttt gctggcccag cgaaagctag acataaacta      2340
     taccccttaa accacctata tgctggtaaa cagggattcg aaatcgacta tgttgtgtct      2400
     ttcataataa tgtgttccga ctatgagacg aacggtgatg ctgctgaaaa ggtcattgag      2460
     ctctttttgc aactagccag aagcttgcca actaacctta tatttcaagc gttaccaaca      2520
     ttaatcacat atatcggttc aaacgacaga gaaaacatat ctgaggacac tttattggcc      2580
     ttgactgaat ttaccggctc atctctttta acaaacgaat acaatacatc taccctttcg      2640
     ataacttatc tgtccctgtt tcttaaatct atctcacgtt attggctcag cgatacgcac      2700
     atgccctctt taaccgctga ttgcaatgat atattggagt ggatattttc gcgcctaggt      2760
     gactcttcat gtattgggtg tgaagccata atggccattt tagatatgac gctccatatg      2820
     ttgaaaaatt acaatcgttc gaattccaag tttactttcg acaaacaaca cttatttcat      2880
     gtgctaacga catgtctggg gaggctcccg aaattctata tatgcaaggt tgttcatgaa      2940
     ttaaactcct atgttgttcg tctagggtta aagaaccaga gtattatatt ttctgaattt      3000
     gccggtctat ttgacccccc tcaaagggat gcagagaccg cagcatacta ttcgctgaca      3060
     ttagctggtc ttgggacgat ttctcacatg cacttgtcaa atgctatact tcatgttttg      3120
     cctaacttgc aacacaaaca tgttagtcaa tatgcactgt catttttaaa gtcagttgcc      3180
     ggctttcata agttatctgg tatcagagca ttatttcatt tatgtcgctt tgagatcctt      3240
     gacatatggt ctaataagtg tgcgggactt cgagatttct cacctatatg gaatacagcg      3300
     atcttccagt tcgagagctt cgagcagttt attaatgaat ataagcatga ggtcgctgcc      3360
     tactattttg caaagctctc accataccac tatcttaagt ctactttggt taatgatgac      3420
     aaagaacttc cacaattgct tgaaatttca ttgcaatatg caatcccatt ggcctacata      3480
     cctggaggaa ttggcgacgc aatattcgat atctgcgcag atcaatggag tgctacgaac      3540
     catacgaatg ttttaaaaca acagtatctg ctaatttttg atcgattgtt acattttgct      3600
     gacctgactg tattcatgga atattttgag agtttgcaaa aggtttatac gaattctgag      3660
     ttaattcaca aaatgaaaaa atacacctat aacctacatc cgaaacacct tttgtcatat      3720
     tctttacgaa ctgctttgaa agtcatccac tccaaagtgt tactcggtaa actgtccata      3780
     caggaattga gatttctctt aaccttaaat ctccaatatt tacaggagag tacgttacca      3840
     gatgatcgca gccagattct tagaaaaatc caaattattt tggtagcgta tgagcaacaa      3900
     ttggaagatg catcttcggt ttctgacctc ttggagattc ttacagatta cttagatgat      3960
     cctctgctgg gcaatgaggt gggtgcactg attggctcca tagtagcctt gggatttaac      4020
     gtcaaataca ctgaaagttt gttcctatgc atatttgcta aacttctacc tcaactgcat      4080
     gaggcgaaaa ccgcaaatct ttctattctg ctgaacgaca tcagtaatac actcacgatt      4140
     aacaattcta atatcataca tggtaagtgg tggcatgcct gtattgatgc gttagcaggt      4200
     accagtttgt ttgaaaatac tatttaccat gacgactccc tgttagacac cgaactgctt      4260
     gatcatcgtg cgctgaactt atattctgaa atattgtctt tcctaccacc attcactggc      4320
     tttcccccga actttgttcc taaagagaga gtattgcggc atttgatatc gcagacaact      4380
     acttttaagc tgcatgataa tttccttctc tggaaaggac attatattgg gatgtatcac      4440
     aaatttcacg gaacaatccc gcaattagca cctaatggtc ctaatcaaaa actgtccatt      4500
     gataaactag taaagaacta tggcttgctg aatggaattt ttgagctttt ggaggccata      4560
     gagaaaacta cccatgccag aataaagttc atatgccagt gtatcaatgc tgtctctctt      4620
     agccacaaag attcgctttc tacgtttact gcggatacgc agcagttttt tggtcagtta      4680
     tcttctaaat ctgtaccact ggatttagcg ctctttttct acatgttccc catatcaaat      4740
     cccagtgagt ctatggaaac cttctgcaga ttgcattatc ctgcgttaac gtctgattat      4800
     tcatcatggc ttgtaaaact caccatgttc gctcttgata tgttggggcg ttatattccg      4860
     gtagtaaagt gttttgaggt actggctacg gctataacca gtagggtcga acaattgttg      4920
     aactattggc tactattgtt actatactgt gatcctaata acggtataag gctactatgc      4980
     actctaatat ccaacattgg gttactgaag tccaccaaag agggtatcct aaagattaag      5040
     tacatgttaa atcttcttct catcgtcaga tctttccata aactgggtta caaggagttt      5100
     gatacaatct atgatcgcat tagcctgcaa gatgcttata aagtggcagc agaagtggga      5160
     gagaagtata ttgcctgtct actttttgaa gaattccaca tgccgaactt ggctcgcttg      5220
     gacgtcacgt acatgaagga gatttataaa cagtttgatg acgttgatat gatatatggg      5280
     ataccgacga cagcatcctt ggcatcagca attgagctca taaatcagac tcaggctaca      5340
     agtttaaaaa gcttcatgat gaataatggc aactttgatg cgcagtatgc cactcatttc      5400
     acgggcaata ttggtaattt ggttaattct gcatccaata atgggtttac tggattagca      5460
     tatgcattac agaatatttc ttcttcgaaa aatacatcag caacctataa ctggtgtatt      5520
     gaactagaca aatgggatct acccacgccg gacatcctgg actcaaccgc caagtcgata      5580
     tattctataa tcaaaaagac agatatcaac acaggaactg cagaagcggc ctttaaaagc      5640
     acgatgttga atgcattaca atttctagag aaaactggag ttaatgaaga taatgtttca      5700
     cagttgggta gcatagtgac aatggtccag ttgtacaata acaacgccga aaaattggtg      5760
     aaatccctac atgctcaaga tcgtaaaatt cttaaagtta aagattttaa tgactattat      5820
     atggatatca aggtgcgtca tgtctttctg gaccatctga ttgattctca caagaatcgg      5880
     ctttcggaag agcaatctat ctgtttgcgt tttgccagta tctgtgaact ttcacacttg      5940
     agtgaggttg ccagaggagc ttctgatttc cagcgatcat tggatgctgt gcttctcttg      6000
     gagaaaagtg tgctagcact tcctactaat tcttcagttg aacattatgg cttattcaaa      6060
     acttttgcta ggcggatgtc aacaattcaa tctgcaaaga tgttatggtc acaaaatgaa      6120
     acggtaatgt ccattgacat gctgaaagac ttactacata cgccactcag cagcaacctt      6180
     attgcgcgag caagaaagca accctttttt caacagatgg ccattcttga tattaatgtc      6240
     aaggcccaat tggtgcaatg gttatcacat tcgagacagg atgttcctga acgcatcttt      6300
     aaaaactaca ttggcacatc gctgcaagat atcgaaaatt acggtgacaa tccttcaaga      6360
     accgaaatag tccatacctt tgggaaattc tgttacgatc aggccaagcg ttttagtgag      6420
     accaacgagg tagacataat ggcacggcgg gtgtctaaga acaaagaaga gttagcggcg      6480
     ctttatcaac tgtaccatga tagatcctta ccagagcgtg aaaggaagga ggcgaaaagg      6540
     cattacgcaa gattactggt aagaaaccag caggaaacag agacctacaa tcagctgcgg      6600
     gatcaaaggg aactttttgt caccaatgcg ttgttatttt ttacccagac gttgcagtat      6660
     gatgatctgt atgatggaga agtaattgac cagttttgcg gcctatggtt tgaatattca      6720
     aatgacgata atgttagtgg aaagctgctg tcaaatctcc agaatatacc agaatataaa      6780
     ctactaccat ggatcaatca gatggcttcg aaattagccg atgatgagtc accctttcag      6840
     aagaccttac gcgcagcgat ggtgcgtatt ttactgaagt tgccatatga ctctctatac      6900
     gtattgattg gtatgtcatt gacaggcagt cggcaaaacg caaaggattc gggctcccag      6960
     tctcgcctcg tggcagttga gagcttgcta aaggaagtaa gcaaacacga ctatggaagc      7020
     tatgccacga aatatcttct tccagttcgg gaattttgtg aaatgagtgt atcactggca      7080
     tctcaaaaat tcgcacaaaa tactagaaag atacacctga ataatttaaa gattggtacc      7140
     tattggctaa aggaactgaa aggcaggaaa ctcccacttc ccaccgcaca atccagggtc      7200
     tccgaccgat gtgggaacag tgtatcaagg tcatacatta cccaagtaga tccagacgtt      7260
     cgaattgcca gttctggtct ttcacttccg aagattgtca cctttacgtt aagtgacggt      7320
     acgaggcatc gcgcattatt gaaagcaggt aatgacgacc taagacaaga cgccattatg      7380
     gaacaagtct ttaagcaagt gaacaaaatt ctgacgtcca ataagaggac tagaaaactc      7440
     aaattgcgga taagaacata tgaagtcatc ccactgggcc cccaagcggg tattattgaa      7500
     tttgcgccga attccaaatc cttgcacgag atacttgcgg gataccacaa ggatgatacc      7560
     atatctcttg aacaagcgag aaaagcgatg aaagccgtcc aagggaaatc caaggagcaa      7620
     cgcattgcag tgtatgtgaa aatcactgaa tcggtgaaac cagtgcttcg taatttcttc      7680
     tatgagacct ttttagaccc tgaggaatgg ctgctcgcca aggctaccta tacgaaaggc      7740
     gttgtgacaa actccattgt cggccacatt cttggtctgg gtgataggca tctgaataat      7800
     atccttctgg ataagtttac tggtgaacca attcacattg atcttggtgt cgcctttgac      7860
     cagggcaaac tgctcccgct gccggaactg gttccgttca gactcaccag agacattgtc      7920
     gatgggtttg gcgtcatggg ggtggagggg ctgttccgga agaactgtga aaaggtgtat      7980
     ggcttgttga ggaaggaacg cgaacgagtc atgtgcgtgt tgaacgtctt gaagtgggat      8040
     ccactgtatt catggaagat gacgccgctg cgtagacaga agctacaggg gaagctggtc      8100
     gacggcgaca gcccgtcgga ctccctcgtg acgagccttc ctgacagctc tgacaacgac      8160
     gagtcacggc gcgcgctcaa gggcgtggag gacaagctgc ttgggaacgg gctgagcgtg      8220
     gaggcgaccg tgcaggagct ggtgcaccga gccacggacg tgtcaaacct ggccgtcata      8280
     ttcatgggtt ggtcgccctt ctactag                                          8307
//

If you have problems or comments...

PBIL Back to PBIL home page