(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE90

ASHGO_7.PE90         Location/Qualifiers
FT   CDS_pept        complement(182863..183258)
FT                   /codon_start=1
FT                   /gene_family="HOG000231288" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774759"
FT                   /gene_name="RPL32"
FT                   /locus_tag="AGL281C"
FT                   /product="60S ribosomal protein L32 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS54210.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG069834"
FT                   /db_xref="HOGENOM:HBG497568"
FT                   /db_xref="InterPro:IPR001515"
FT                   /db_xref="InterPro:IPR018263"
FT                   /db_xref="UniParc:UPI0000253349"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751I7"
FT                   /transl_table=1
FT                   /translation="MAASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRR
FT                   RFRGQISEPTIGYGSNKKTRFMTPSGHKTYLVSNIKDLEVLMMHTKTYAAEIASNVSSK
FT                   NRVSILARAKALGIKVTNPKGRLALEA"
     atggccgctt ctctacctca ccctaagatt gtgaagaaac acaccaagaa gttcaagcgc        60
     caccactctg accggtacca cagagtcgct gagaactgga gaaagcagaa gggtatcgac       120
     tctgttgtca gaagaagatt cagaggccaa atctccgagc caaccatcgg ctatggttcc       180
     aacaagaaga cccgtttcat gacgccatcc ggccacaaga cttacttggt ctctaacatc       240
     aaggacctag aggtcttgat gatgcacacc aagacctacg ctgctgagat tgccagcaac       300
     gtttcttcca agaacagagt cagcatcttg gccagagcca aggctttggg catcaaggtc       360
     accaacccta agggcagact ggctttggag gcttga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page