(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE91

ASHGO_7.PE91         Location/Qualifiers
FT   CDS_pept        183784..184407
FT                   /codon_start=1
FT                   /gene_family="HOG000000709" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927770"
FT                   /gene_name="ROX3"
FT                   /gene_synonym="MED19"
FT                   /locus_tag="AGL280W"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 19"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS54211.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG060115"
FT                   /db_xref="HOGENOM:HBG204148"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniParc:UPI000025334A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751I6"
FT                   /transl_table=1
FT                   /translation="MGTVHDDATMPSYYYYVDPAGPAYEPQQPNPIDDLISVYGLQDIS
FT                   RQVARTNADGTKAVKLRKSYKNQIQDLSGKFSVIPTRENGKGGEISPIVFQNTDGDAVR
FT                   ERGMGPEEWRRAQVFRDQALFEAPTMDWDMCAEVISQFERSYPGEFKNQGFEVEDLAFD
FT                   LDGSGANGAALGGKAKKRKSRSNGSSMATPNSDLQEDIKRRRLE"
     atgggcacgg tgcatgacga cgccacgatg ccgtcctact actattacgt agaccccgcc        60
     ggacccgcgt acgagccgca gcagccgaac cctatagatg acctaatatc ggtatacgga       120
     ctccaggaca tctcgcggca ggtagcacgc accaacgcag acggcaccaa ggccgtcaag       180
     ctgcgcaagt cgtacaagaa ccagatacag gacctgtccg gcaaattctc tgtgatccct       240
     acgcgcgaga acggcaaggg gggggaaata tcgccgatcg tgttccagaa caccgacggc       300
     gatgcagtgc gcgagcgggg catgggcccg gaggaatgga ggcgcgcaca ggtgttccgc       360
     gatcaggcac tgttcgaggc cccgacgatg gactgggaca tgtgtgcaga ggtgatttcg       420
     cagtttgagc ggagttaccc gggcgagttt aagaaccagg ggttcgaggt agaagacctg       480
     gcgttcgact tggacgggtc gggcgccaac ggggccgcgc tgggcggcaa ggcaaagaaa       540
     cgcaaaagca ggtccaatgg gtcgtccatg gcgacgccga acagcgacct gcaagaagac       600
     atcaagcggc ggcggttgga atag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page