(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE97

ASHGO_7.PE97         Location/Qualifiers
FT   CDS_pept        193740..195938
FT                   /codon_start=1
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20622199"
FT                   /locus_tag="AGL274W"
FT                   /orf_name="AGOS_AGL274W"
FT                   /product="AGL274Wp"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54217.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI0000253350"
FT                   /db_xref="UniProtKB/TrEMBL:Q751I0"
FT                   /transl_table=1
FT                   /translation="MGLPSVLVSESGTLSARFAAKMISSQLGILGPALRRSGVQLRHNH
FT                   MSRLASMRRGMHITGAARNKQEEGASAEQGQGASGISHAMLAAKEQEANRDLLDAGAQA
FT                   ALYRLLLAANYPQYVVSRFETPGIASSAECVSLYSEALQKVGRQADADAVRRSVGAPAG
FT                   AEAAAAVSPAGASAGSGYGGPVFPGAGMYGAGQGTRKEPLHVVVTESTFTVISRWIKWL
FT                   LVFGLVTYGVSEGFRYITENTTLLKSAETADKSVDVAKTNVKFEDVRGCDEARAELEEI
FT                   VDFLKDPAKYESLGGNLPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYV
FT                   GVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKDQAYAKQTLNQLLVELDGFSQT
FT                   SGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDVRGRADILQHHMRKVTLAPDVDPS
FT                   IIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMTHFEWAKDKILMGAERKTMVLTEA
FT                   SRRATAYHEAGHAIMALYTPGAVPLYKATILPRGRALGITFQLPEMDKVDVTKKECLAR
FT                   LDVCMGGKIAEELIYGKDNTTSGCGSDLQNATSTARAMVTQYGMSEQVGPVNLADKWES
FT                   WSGKIRDIADNEVVEILKASEERARNILREKQKELNRLAQGLMEYETLDSVEIQKVCKG
FT                   EPISKAKMSTNKIVEGPDSDDRKEIGGDKSKIPVLINA"
     atggggttgc cgagtgtgct agtgtcagaa tcgggcactt tgagcgctag gtttgcagca        60
     aagatgatat cttctcagct tgggatactg ggccctgccc tgaggaggag cggggtgcag       120
     ttacggcaca atcacatgtc gagactggca agcatgagaa gggggatgca tataacaggc       180
     gcggcgcgta acaagcagga ggagggcgcg agcgcggagc agggtcaggg cgcgagcggc       240
     atctcgcacg cgatgctggc ggccaaggag caggaggcga atcgagacct gctggacgcg       300
     ggggcgcagg cggcgctgta ccggctgctg ctcgcggcga actacccgca gtacgtggta       360
     tcgcggtttg agacgcctgg gattgcgtct tctgcagagt gcgtgtcgct gtacagcgag       420
     gcgctgcaga aggtggggcg ccaggcggat gcggacgccg tgcggcggtc tgtgggggcg       480
     ccggcaggcg ccgaggctgc tgcggcggtc tctcctgcgg gtgcttcggc aggcagtggg       540
     tacggcgggc ccgttttccc cggggccggg atgtacggcg ccggccaggg gacacgcaag       600
     gagccgctac acgtggtggt aacggagtct accttcacgg taatctcgag gtggatcaag       660
     tggctgctgg ttttcgggct tgtcacttat ggtgtttcag aagggttcag gtatatcacg       720
     gagaacacta cgctactgaa gtccgcggag actgcggaca agtctgtgga cgttgccaag       780
     accaatgtga aattcgagga tgttcgcggc tgtgacgaag ctcgcgcaga attggaggaa       840
     attgtggact ttttgaagga ccccgcgaag tacgagtccc tcggtggaaa cctgcccaag       900
     ggtgtcctat tgactggtcc ccctggtacc ggtaagactc tgcttgcaag agccactgca       960
     ggcgaggctg gtgttgattt cttttttatg tctggttcgg agtttgatga ggtatacgtc      1020
     ggtgttggtg ccaagcgtat acgtgagctt ttcgcgcaag cgcgcgctcg tgcacccgct      1080
     atcatcttca ttgatgaact agatgccatc ggaggaaagc ggaatcctaa ggaccaggcc      1140
     tacgccaagc agactttgaa tcagttgttg gtggaactag atgggttctc tcagacaagt      1200
     ggtatcatca ttattggtgc gacgaatttc cctgaatcct tagacaaggc tctaacgaga      1260
     cctggtagat ttgacaagat tgttaacgtc gacctcccgg atgtccgtgg ccgtgccgac      1320
     attcttcagc accatatgag gaaagtcacc ttggctcctg acgtggatcc tagtattatt      1380
     gcccgtggta cgcctggtct atccggtgca gaattgatga atttggttaa ccaggcggca      1440
     gtatacgcat gccagcaaaa tgccattgcc gttgacatga cacattttga atgggctaag      1500
     gacaagattc tcatgggtgc tgagcggaaa actatggtct tgacggaggc ttccaggaga      1560
     gccactgcgt accacgaagc tgggcacgcc attatggctc tatatactcc aggtgcggtt      1620
     ccattgtaca aggcaaccat ccttcccaga gggagagccc tcgggataac tttccagctt      1680
     cctgaaatgg ataaggtgga tgtcaccaag aaggagtgtc tggcgcgtct agatgtgtgt      1740
     atgggtggga agatagcaga agaattgatc tatgggaagg ataacaccac cagcggctgt      1800
     ggttcagact tgcaaaatgc taccagcaca gcgcgggcaa tggtcacgca gtatggtatg      1860
     agtgaacaag taggtccagt taacttggct gataagtggg aaagctggtc gggtaagatc      1920
     cgtgatattg cagacaacga agtcgtggaa atattaaaag cctctgaaga gagagccaga      1980
     aatattctac gcgagaagca aaaagaattg aacagactag cacaaggcct aatggagtac      2040
     gaaactttgg acagcgtaga aatccagaag gtttgtaaag gtgagcctat ttccaaggca      2100
     aagatgtcca ccaataagat tgtagagggt ccagatagcg acgatcgcaa agaaataggc      2160
     ggcgataaat ccaagatccc cgtcttgatc aatgcataa                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page