(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE99

ASHGO_7.PE99         Location/Qualifiers
FT   CDS_pept        complement(197944..199587)
FT                   /codon_start=1
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079001"
FT                   /locus_tag="AGL272C"
FT                   /orf_name="AGOS_AGL272C"
FT                   /product="AGL272Cp"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="AAS54219.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017458"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI0000253352"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H8"
FT                   /transl_table=1
FT                   /translation="MLSRTVIRSARSLAAVQLGRTVARVARPAVMIAGRRFASAKAQPT
FT                   EVSSILEERIRGVSEEANLNETGRVLSVGDGIARVFGLNNVQAEELVEFSSGVKGMALN
FT                   LEPGQVGIVLFGSDRLVKEGEVVKRTGKIVDVPVGPEMLGRVVDALGNPIDGKGAIKAS
FT                   GTSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTI
FT                   LNQKRWNSSNDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSVIVAATASEAAPL
FT                   QYIAPFTAAAIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYL
FT                   HSRLLERAAKMSEKNGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKG
FT                   IRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLA
FT                   RGERLTQLLTQSQYSPLAAEEQVPLIYAGVNGYLDNIELSRIGEFEKEFLAYLKASHEE
FT                   IVSAIREKGELSKDLLAKLKSATESFVATF"
     atgttgtccc gtactgtcat ccgttccgcc aggtcccttg ccgctgtgca gctgggcaga        60
     accgtggcca gagtcgcgcg cccggccgtg atgatcgccg gccgcagatt cgcctctgcc       120
     aaggcgcagc cgaccgaggt gtcgtcgatc ctggaggaga ggatccgcgg cgtgtccgag       180
     gaggcgaacc tgaacgagac cggccgcgtg ctgtctgtcg gagacggtat cgcccgtgtg       240
     ttcggcctga acaacgtgca ggcggaggag ctggtggagt tctcgtcggg cgtgaaaggt       300
     atggcgctga acttggagcc cggccaggtg ggtattgtgt tgttcggctc tgaccgtctg       360
     gtcaaggagg gcgaggtcgt gaagcggacc ggtaagattg tggacgtgcc agtgggccca       420
     gagatgctag gccgtgttgt ggacgcgcta ggtaacccaa tcgacggcaa gggcgccatc       480
     aaggcctccg gcacctcccg tgctcaggtc aaggccccag gtatcctgcc aagacgctct       540
     gtgcacgagc cagtgcagac cggtttgaag gccgtggacg ctcttgtgcc tattgggaga       600
     ggccagagag agttgattat tggtgacaga cagaccggta agaccgctgt ggccttggac       660
     accatcctga accagaagag atggaacagc tccaacgacg aatccaagaa gctatactgt       720
     gtctacgttg ctgttggtca gaagagatcc accgtcgccc agttggtgca gaccttggag       780
     cagcacgatg ccatgaagta ctccgtcatt gttgcggcca ccgcttccga ggccgctcca       840
     ttgcagtaca ttgctccttt cactgctgct gccatcggtg agtggttcag agacaacggc       900
     aagcacgcat tgattgtcta cgacgacttg tccaagcagg ccgttgccta ccgtcagttg       960
     tctttgctgt tgagacgtcc tccaggccgt gaggcttacc caggtgacgt tttctacttg      1020
     cactctcgtc tattggagag agccgccaag atgtccgaga agaacggcgg tggttccttg      1080
     accgctttgc ctgtgattga gacccagggt ggtgatgtct ctgcgtacat tccaaccaac      1140
     gtcatttcca tcactgacgg tcagatcttc ttggaggctg agttgttcta caagggtatc      1200
     agaccagcta tcaacgtcgg tttgtctgtc tcccgtgtcg gttccgccgc ccaggtcaag      1260
     gccttgaagc aggtcgcagg ttctttgaag ctgttcttgg ctcagtacag agaagtggct      1320
     gcgttcgccc agtttggttc cgacctggac gcctccacca agcaaacctt ggctagaggt      1380
     gagagattga cccaactatt gacccagagt cagtactccc cattggccgc cgaggagcaa      1440
     gttcctttga tctacgccgg tgttaacggt tacttggaca acatcgagct atccagaatt      1500
     ggcgagttcg agaaggagtt cttggcctac ttgaaggcta gccacgagga gatcgttagc      1560
     gctatcagag aaaagggtga attgtccaag gacttgttgg ctaagttgaa gtctgctact      1620
     gagtctttcg ttgctacctt ctaa                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page