(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_8

ID   ASHGO_8; SV 1; circular; genomic DNA; GRV; FUN; 23564 BP.
XX
AC   AE016821_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 13)
XX
DE   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-
DE   1056) mitochondrion, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Eremothecium.
OG   Mitochondrion
XX
RN   [1]
RX   PUBMED; 15001715.
RA   Dietrich F.S., Voegeli S., Brachat S., Lerch A., Gates K., Steiner S.,
RA   Mohr C., Poehlmann R., Luedi P., Choi S., Wing R.A., Flavier A., Gaffney
RA   T.D., Philippsen P.
RT   "The Ashbya gossypii genome as a tool for mapping the ancient
RT   Saccharomyces cerevisiae genome.";
RL   Science 304:304-307(2004).
XX
CC   This Genome Reviews entry was created from entry AE016821.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23564
FT                   /organism="Ashbya gossypii"
FT                   /strain="ATCC 10895 = CBS 109.51 = FGSC 9923 = NRRL Y-1056"
FT                   /mol_type="genomic DNA"
FT                   /organelle="mitochondrion"
FT                   /db_xref="taxon:284811"
FT   tRNA            505..573
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        660..1406
FT                   /codon_start=1
FT                   /gene_family="HOG000264988" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080155"
FT                   /gene_name="COX2"
FT                   /gene_synonym="CoxII"
FT                   /locus_tag="AMI001W"
FT                   /orf_name="AgCOX2"
FT                   /product="Cytochrome c oxidase subunit 2 "
FT                   /EC_number="1.9.3.1"
FT                   /function="copper ion binding"
FT                   /function="cytochrome-c oxidase activity"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="AAS50168.1"
FT                   /db_xref="EMBL:AAP57840.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG316213"
FT                   /db_xref="HOGENOM:HBG390534"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR015964"
FT                   /db_xref="UniParc:UPI00002523BA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YFV7"
FT                   /transl_table=3
FT                   /translation="MLLMNLFTIINNDVPTPYNMYFQDSTTPHQEGILELHDNIMFYML
FT                   TVLGLVSWMMIIIIKDYKNNPITYKYIKHGQMIEIIWTILPAIILLMIAFPSFILLYLC
FT                   DEVISPAMTIKVIGLQWYWKYEYSDFINDNGETIEYESYMIPEELLEEGQLRMLDTDTS
FT                   IVIPVDTHVRFIVTATDVIHDFAVPSLGIKIDTTPGRLSQVSTLIQREGIFYGQCSELC
FT                   GAQHSAMPIKIETVKLPTFLTWLNEQ"
FT   sig_peptide     660..695
FT                   /gene_name="COX2"
FT                   /locus_tag="AMI001W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YFV7 "
FT   mat_peptide     696..1403
FT                   /gene_name="COX2"
FT                   /locus_tag="AMI001W"
FT                   /product="Cytochrome c oxidase subunit 2 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YFV7 "
FT   tRNA            1777..1848
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        1957..3564
FT                   /codon_start=1
FT                   /gene_family="HOG000085274" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753602"
FT                   /gene_name="COX1"
FT                   /locus_tag="AMI002W"
FT                   /orf_name="AgCOX1"
FT                   /product="Cytochrome c oxidase subunit 1 "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="aerobic respiration"
FT                   /biological_process="electron transport chain"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="AAS50169.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0009060"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG411475"
FT                   /db_xref="HOGENOM:HBG603668"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="UniParc:UPI00002523BB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62514"
FT                   /transl_table=3
FT                   /translation="MYLQRWLFSTNAKDIAILYFIFSTFCGLAGTAMSFIIRMELSAPG
FT                   QQYLQGQNQLFNVLVTGHTILMVFFLVMPMLIGGFGNYYLPLMIGASDMSFARLNNISF
FT                   WTLPPTLICLLTSTMVESGTGTGWTVYPPLSSIQSHSGASVDLAIFSLHLTTISSLLGT
FT                   INFIVTALNMRTNGMTLHKMPLFTWSILITAVMLLMSLPVLSAGVTMLLMDRNFNTSFF
FT                   EVQGGGDPILYQHLFWFFGHPEVYIMIVPTFGMMSHIVSTYSKKPVFGEISMIYTMGSI
FT                   SLLGFLVWSHHMYVVGLDTDTRAYFTSATMIITIPTSIKVFSWLTTIYGGSLRLTTPML
FT                   YTLSFLFLFTVGGLTGVVLANTSLDVAFHDTYYVVTHFHYVLSLGAVFSMFAGYYYWSP
FT                   TVLGLNYNEKLSQIQFWLIFLGTNIIFFPMHFLGINGMPRRIPDYPDTFTGWNLVSSFG
FT                   SMMTIMSLMLFTYIIYDQLMNGLTNKVNNKSINYMKTPDFIESNNIFLMNTTKSSSIEF
FT                   MLNSPPTIHSFNTPTIQS"
FT   tRNA            3601..3672
FT                   /gene_name="tRNA-Thr"
FT   CDS_pept        3857..4666
FT                   /codon_start=1
FT                   /gene_family="HOG000264954" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080156"
FT                   /gene_name="COX3"
FT                   /locus_tag="AMI003W"
FT                   /orf_name="AgCOX3"
FT                   /product="Cytochrome c oxidase subunit 3 "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="mitochondrial electron transport,
FT                   cytochrome c to oxygen"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50170.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006123"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG118928"
FT                   /db_xref="HOGENOM:HBG565518"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="UniParc:UPI00002523BC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G34"
FT                   /transl_table=3
FT                   /translation="MLYLNRSKFQQFPFHLVTPSPWPIVTSFSLLGLTLTLAFTMHGII
FT                   GNIYPLLLSLLVVLLTMTLWFRDIVAETTYLGDHTLAVRKGINLGFTLFVVSEVLIFAS
FT                   LFWAYFHSAMSPDITLGNVWPPVGIEAVQPTELPLLNTIILLASGTTITYSHHGLIEGN
FT                   RKHALSGLTITFWLIVTFVLCQYIEYSNTSFTITDGIYGSVFFAGTGLHFLHMVMLTIM
FT                   LGINYWRMRNYHLTSTHHVGYETTTIYLHVLDIIWLALYICFYWWGV"
FT   tRNA            4870..4941
FT                   /gene_name="tRNA-Phe"
FT   tRNA            4944..5027
FT                   /gene_name="tRNA-Leu"
FT   tRNA            5042..5114
FT                   /gene_name="tRNA-Gln"
FT   tRNA            5120..5191
FT                   /gene_name="tRNA-Lys"
FT   tRNA            5194..5265
FT                   /gene_name="tRNA-Arg"
FT   tRNA            5279..5350
FT                   /gene_name="tRNA-Gly"
FT   tRNA            5375..5446
FT                   /gene_name="tRNA-Asp"
FT   tRNA            5452..5533
FT                   /gene_name="tRNA-Ser"
FT   tRNA            5539..5610
FT                   /gene_name="tRNA-His"
FT   tRNA            5758..5828
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        5926..6945
FT                   /codon_start=1
FT                   /gene_family="HOG000138209" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080157"
FT                   /gene_name="VAR1"
FT                   /locus_tag="AMI004W"
FT                   /orf_name="AgVAR1"
FT                   /product="Ribosomal protein VAR1, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrial ribosome"
FT                   /protein_id="AAS50171.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005761"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG060119"
FT                   /db_xref="HOGENOM:HBG512138"
FT                   /db_xref="InterPro:IPR007980"
FT                   /db_xref="UniParc:UPI00002523BD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G41"
FT                   /transl_table=3
FT                   /translation="MKYNLLNNMKINNKKLKLKLILMMITMKRLNNMNQHNIYKNRYYN
FT                   KNNNLQYLNKLNTYNNKMYYFNKQLMNNMLIIDNTFNNLLKKMMMSNNILMTNLKFEHR
FT                   TNSIHIKYYFYNYMNINNDELSKLYNNYMMSINNQMINLLNNDNNSLNNLMTKYYNKKV
FT                   YINTYKLNYMYLDTELLSQTLTNIYNNNGLSLKSLKMIINKLPFNNDMLLSKNYVNKMN
FT                   KYNLTINNNLNNNKKDLINLYTLDNKLLDLSITNNMLLGKYLVGSNIQLKGRTLNRNIT
FT                   RTMKMNIMKGTFNNYMYQWSKLNNLYKLNYMSTNINKTNNTFINKNGMFNIKIKLNTI"
FT   CDS_pept        7040..7186
FT                   /codon_start=1
FT                   /gene_family="HOG000034188" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753603"
FT                   /gene_name="ATP8"
FT                   /locus_tag="AMI005W"
FT                   /orf_name="AgATP8"
FT                   /product="ATP synthase protein 8 "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAS50172.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059889"
FT                   /db_xref="HOGENOM:HBG398772"
FT                   /db_xref="InterPro:IPR009230"
FT                   /db_xref="UniParc:UPI00002523BE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G40"
FT                   /transl_table=3
FT                   /translation="MPQMIPFFFMNQLTYGFTFILTILFLTSYVFLPMILRLYISRLYI
FT                   SKL"
FT   CDS_pept        7252..8043
FT                   /codon_start=1
FT                   /gene_family="HOG000253874" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753604"
FT                   /gene_name="ATP6"
FT                   /locus_tag="AMI006W"
FT                   /orf_name="AgATP6"
FT                   /product="ATP synthase subunit a "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="AAS50173.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG261838"
FT                   /db_xref="HOGENOM:HBG734175"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniParc:UPI00002523BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G39"
FT                   /transl_table=3
FT                   /translation="MYLNNNNNMKYYINSPLEQFEIRDLLGLTSPMMDFSFINITNFGL
FT                   YTMITLLVILTMNLMTNNYNKLVGSNWYLSQEMIYDTIMNMVKTQIGGKVWGYYFPLVY
FT                   TFFITIFTMNLISMIPYSFAMTSHVVFVVSMSMIIWLGTTIIGFYTHGLKFFGLFLPTG
FT                   TPLILVPLLVSIELLSYFARTISLGLRLSANIMAGHLLIVILGGLLFNLMAMNILTFLL
FT                   GFLPMIAILGIVCLEFAITIIQAYVWCILMSSYLKDTIYLH"
FT   pro_peptide     7252..7293
FT                   /gene_name="ATP6"
FT                   /locus_tag="AMI006W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G39 "
FT   mat_peptide     7294..8040
FT                   /gene_name="ATP6"
FT                   /locus_tag="AMI006W"
FT                   /product="ATP synthase subunit a "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G39 "
FT   tRNA            8226..8297
FT                   /gene_name="tRNA-Trp"
FT   CDS_pept        8389..8619
FT                   /codon_start=1
FT                   /gene_family="HOG000235245" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623378"
FT                   /gene_name="ATP9"
FT                   /locus_tag="AMI007W"
FT                   /orf_name="AgATP9"
FT                   /product="ATP synthase subunit 9, mitochondrial "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /function="lipid binding"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="AAS50174.1"
FT                   /db_xref="GO:0008289"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG514500"
FT                   /db_xref="HOGENOM:HBG753983"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniParc:UPI00002523C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G38"
FT                   /transl_table=3
FT                   /translation="MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALIQGVSRNPSMKD
FT                   TLFQFAILGFAISEATGLFCLMISFLLLYGV"
FT   tRNA            8657..8729
FT                   /gene_name="tRNA-Thr"
FT   tRNA            8749..8820
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        9139..10293
FT                   /codon_start=1
FT                   /gene_family="HOG000255206" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080158"
FT                   /gene_name="COB"
FT                   /gene_synonym="COB1"
FT                   /gene_synonym="CYTB"
FT                   /locus_tag="AMI008W"
FT                   /orf_name="AgCOB1"
FT                   /product="Cytochrome b"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="respiratory electron transport chain "
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="AAS50175.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG096336"
FT                   /db_xref="HOGENOM:HBG487932"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR016175"
FT                   /db_xref="UniParc:UPI00002523C1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62513"
FT                   /transl_table=3
FT                   /translation="MAYRKSNLYLNLVNSYVIDSPQPSSINYWWNLGSLLGLCLVIQIT
FT                   TGIFLAMHYSSNIELAFSSVEHIMRDVQTGWLIRYMHTNGASFFFICMYIHIGKGLYYG
FT                   SYKSPRVIVWTVGVIIFILTMAAAFLGYCLVYGQMSHWGATVITNLFSAIPFIGNDIVT
FT                   WLWGSFSVSNPTIMRFFTFHYLVPFIIAAMVIMHLMTLHVHGSSNPLGITGNLDRLPMH
FT                   GYFIFKDLVTVFVFMIFFSLFVFFSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYTI
FT                   LRSIPDKLGGVITMFGTILVLLMLPITDRSIIRGNTFKTLSKFFFFLFITNFILLGKLG
FT                   ECHVEVPFILMGQICTFIYFAYFLILVPIISMIENILFYLTNKK"
FT   tRNA            10504..10589
FT                   /gene_name="tRNA-Ser"
FT   rRNA            10621..12190
FT                   /gene_name="15S ribosomal RNA"
FT   tRNA            complement(12462..12534)
FT                   /gene_name="tRNA-Cys"
FT   tRNA            complement(12808..12880)
FT                   /gene_name="tRNA-Ile"
FT   tRNA            complement(12902..12973)
FT                   /gene_name="tRNA-Ala"
FT   tRNA            complement(12989..13060)
FT                   /gene_name="tRNA-Asn"
FT   tRNA            complement(13076..13160)
FT                   /gene_name="tRNA-Tyr"
FT   rRNA            13422..15101
FT                   /gene_name="21S ribosomal RNA"
FT   tRNA            18723..18794
FT                   /gene_name="tRNA-Met"
XX
SQ   Sequence 23564 BP; 9600 A; 1943 C; 2490 G; 9531 T; 0 other;
     aaattattta atttatttac ttatttattt acacatttat ttatttacta attattatta        60
     cttaagaact tattatcatg aatatatatt aatattataa agtattaata tgtataaggg       120
     gttactaggg gtatatagag tacttatgga aattaaggag gatatagata ctagaggagt       180
     tactgggggt actagagtac ttgaggtact agggttacta acgaacggag cgtttactgg       240
     gaatatggat actaacaaat acagttacat aggatagaat gcacaagggg ggaaatataa       300
     aaggtatgag ggcgaattag gatttcacat tattgaggat tacaagggaa gtcgagtaag       360
     ttttactttg tgaatatgta tataattttt aattcttgag tacttattat tgataaaatt       420
     tagaaacatt ttataagttt tatattaaat ccttcaatga aaaagtagtt agattaaatt       480
     cttcaagatt gatcaaataa aaatagaaat tagcttaatg gtagagcatt cgttttacac       540
     acgaataatt tgagttcgat tctcaaattt ctaaataata attaacaata atttaaattt       600
     gggtaaaaat taataaatat taacgtatat aataattata tactttataa aattactcaa       660
     tgttattaat aaatttattt cttatcatta ataatgatgt acctactcca tataatatat       720
     attttcaaga ttcactacta cctcatcaag aaggtatttt agaattacat gataatatta       780
     tattctatat gttacttgtt ttaggtttag tttcttgaat aataattatt attattaaag       840
     attataaaaa taatcctatt ctttataaat atattaaaca tggtcaaata attgaaatta       900
     tttgaactat tttaccagct attattttat taataattgc atttccatca tttattttat       960
     tatatttatg tgatgaagtt atttcaccag ctataactat taaagttatt ggtttacaat      1020
     gatattgaaa atatgaatac tcagatttta ttaatgataa tggtgaaact attgaatatg      1080
     aatcttatat aattcctgaa gaattattag aagaaggtca attaagaatg ttagatactg      1140
     atactagtat tgttattcct gttgatactc atgtaagatt tattgttaca gctctagatg      1200
     ttattcatga ttttgctgta ccatcattag gtattaaaat tgatctaaca ccaggtagat      1260
     taagtcaagt atcaacatta attcaaagag aaggtatttt ttatggtcaa tgtagtgaat      1320
     tatgtggtgc tcaacatagt gctatgccta ttaaaattga actagttaaa ttaccactat      1380
     tcttactttg attaaatgaa caataattaa tattcttttt ttaatatatt ttatataata      1440
     attaataatt aataattaat tagagagtta gggttcaccc ccctaatgct tatcagcatt      1500
     atgaggtacc actctaatta attaatgtat tccctctaaa taaaagaata ttaattacta      1560
     taaaagatat aaagatataa tataatatca aataatataa taattattta ataataaata      1620
     atatataagc aatattaatc tataaaaatc atataattat ataatataat ttaaataaaa      1680
     taaataaata aataaatgat aataataatt ataaataatt aattaataaa ttatagtgaa      1740
     ataattaata agaaatatgt ttattaagat aatatacaga ttgaaccgag tggtttaggg      1800
     gctgtttttg ggaagcagaa tatgttagtt cgattctaac caatctgaaa atataaataa      1860
     ttaaattaaa attaaataat gattaatcaa aatattaata taaaattatt aataaataac      1920
     tttattattt taattaataa aataataaat aaaactatgt atttacagag atgattattt      1980
     tctacaaatg ctaaagatat tgctatttta tattttattt ttagtacatt ttgtggatta      2040
     gcaggtacag ctatatcatt tattattaga atagaattat cagcacctgg tcaacaatat      2100
     ttacaaggtc aaaatcaatt atttaatgta ttagttactg gacatcttat tttaatagta      2160
     ttctttttag taatacctat attaattggt ggttttggta attattattt accattaata      2220
     attggtgctt ctgatatatc atttgctaga ttaaataata tttcattttg actattacca      2280
     ccactattaa tttgtttatt aacatctact atagttgaat ctggtctagg tactggttga      2340
     actgtttatc ctcctttatc ttctattcaa tcacattctg gtgcttctgt tgatttagct      2400
     attttctctt tacatttaac tactatttct tcattattag gacttattaa ttttattgtt      2460
     acagctttaa atataagaac taatggtata actttacata aaataccttt atttctatga      2520
     tcaattttaa ttactgctgt tatattatta atatcattac cagtattatc agctggtgtt      2580
     actatattat taatagatag aaattttaat acatcattct ttgaagtaca aggtggtggt      2640
     gatcctattt tatatcaaca tttattttga ttctttggtc atcctgaagt atatattata      2700
     attgtaccac tatttggtat aatatcacat attgtatcaa cttattctaa aaaacctgta      2760
     tttggtgaaa tttctataat ttatctaata ggttctatta gtttattagg tttcttagtt      2820
     tgatctcatc atatgtatgt agtaggttta gatcttgata ctagagctta ttttacttca      2880
     gctactataa ttattcttat tcctactagt attaaagtat ttagttgatt actaactatt      2940
     tatggtggtt cattaagatt actaacacca atattatatc tattatcatt tttattttta      3000
     tttactgtag gtggtttaac tggtgtagta ttagctaatc tatcattaga tgtagcattc      3060
     catgatactt attatgtagt actacatttc cattatgtat taagtttagg tgctgtattc      3120
     tctatgtttg ctggttatta ttattgaagt cctcttgttt taggtttaaa ttataatgaa      3180
     aaattatcac aaattcaatt ctgattaatt ttcttaggtc ttaatattat tttcttccct      3240
     atgcatttct taggtattaa tggtatacca agaagaattc ctgattatcc tgatctattc      3300
     ctaggttgaa atttagtatc ttcatttggt tctataataa ctattatatc attaatgtta      3360
     ttcctttata ttatttatga tcaattaata aatggtttaa ctaataaagt taataataaa      3420
     tctattaatt atataaaact acctgatttt attgaatcaa ataatatttt cttaatgaat      3480
     actactaaat catcatctat tgagtttata ttaaattcac cacctcttat tcattcattt      3540
     aatactcctc taattcaatc ttaaaatatt cttaattatt aaattatata ataaaagtta      3600
     gtggatatag tttaattggt aaaacatatg ttttagggac atatatcttc agttcaaaac      3660
     tgaatatcta catattatat cattaatata ataactcttt aattagagtg gtaccacaag      3720
     aatgctgaaa gcattagggg tgtgtacctt agctctctaa ttaaagttat aaaattatct      3780
     taactaataa aaataattaa ttaaataaat aaataattaa ttaaatttaa aatgtttaaa      3840
     aaaagaaata aataatatgt tatatttaaa tagatcaaaa tttcaacaat ttccatttca      3900
     tttagtacta ccatcaccat gaccaattgt tacatcattt agtttattag gtttactatt      3960
     aactttagct tttactatac atggtattat tggtaatatt tatcctttat tattatcttt      4020
     attagtagtt ttattactaa taactttatg atttagagat attgtagctg aacttactta      4080
     tttaggtgat catactttag ctgtaagaaa aggtattaac ttaggtttcc tattatttgt      4140
     tgtatctgaa gtattaattt ttgcttcttt attttgagct tacttccatt cagctataag      4200
     tcctgatatt ctattaggta atgtttgacc accagtaggt attgaagcag ttcaaccaac      4260
     agaattacca ttattaaata ctattatttt attagcatca ggtctaacta ttacatatag      4320
     tcatcatggt ttaattgaag gtaatagaaa acatgcttta tcaggtttac ttattacttt      4380
     ctgattaatt gttacatttg tattatgtca atatattgaa tatagtaata catcatttac      4440
     aattacagat ggtatttatg gttcagtatt ttttgctggt actggtttac atttcttaca      4500
     tatggttatg ttactaatta tgttaggtat taattattga agaataagaa attatcattt      4560
     aacatcaaca catcatgtag gatatgagac tactactatt tatttacatg ttttagatat      4620
     tatttgatta gcattatata tttgttttta ttgatgaggt gtatagtgtt atacattatc      4680
     atttaggtgt gtagggttca cccccctatt gctagtcagc aatatgttgg taccctccta      4740
     aacgataatt caatttaaat attaaaatat taattaataa ataataaata ataaataaaa      4800
     tatataaaag attaatattc attattataa aaatatataa taaaaatata tataaaagat      4860
     taaaagaaag cctttatagc ttagtggtaa agcgataagc tgaagattta ttaacatgta      4920
     gttcgattct cattaaaggc atagctattt tggtggaatt ggtagacacg acactcttaa      4980
     gatgtgttct ttaacaaaag atgaaggttc aaatccttta aatagcattt aattttatta      5040
     atgagctgtt gactaatagg taagtcacca agatttgagt ttggtatatg tttgttcaaa      5100
     tcaaaccagt tcaaatagag ggaatattgt ttaatggtta aaacagttgt cttttaagca      5160
     tctcatgtcg gttcaattcc ggctattcct aaactctctt agcttaatgg ttaaagccta      5220
     atacttctaa tattatgatt ctatgttcaa atcatagaga gagtaatata ataatataat      5280
     agatataagt taattggtaa actagatgtc ttccacacat tatttgtgag ttcgagtctc      5340
     actatctata tttaaataat taaataaata ataaggattt gtagcttaat agtaaagcac      5400
     tatcttgtca cgatagtaga tgtcagtgcg attctgatca aattcgttaa tgaaaagtta      5460
     gctattggta aagcgagtta cttgctatgt aatgaattat taattcttat gagttcgatt      5520
     ctcatacttt tcgtttaagg taaatatatt tcaatggtag aaaagatgct tgtggtgcat      5580
     tcaatatgag ttcaattctc attatttacc ctttatataa aataaatatt attaatctat      5640
     ttaataaata aatattatta tcattttatt aaataaacta aatatcattt agagtggtac      5700
     cacaagaatg cgtaagcatt aggggtgtgt accctaactc tctaaatgat agttaaactt      5760
     atatagctta atggctaaag catttgtctc ataaacaaat aatataggtt cgattccttt      5820
     tataagtatt tttaactaca ttctttataa tattttatta attaattaaa taatgataaa      5880
     atattaatta aataattaat ttaattaaat aaataaataa ataaaatgaa atataattta      5940
     ttaaataata taaaaattaa taataagaaa ttaaagttaa aattaatttt aataataatt      6000
     cttataaaaa gattaaataa tataaatcaa cataatattt ataaaaatag atattataat      6060
     aaaaataata atttacaata tttaaataaa ttaaatcttt ataataataa aatatattat      6120
     tttaataaac aattaataaa taatatatta attattgata atctatttaa taatttatta      6180
     aagaaaataa taatatctaa taatatttta ataactaatt taaaatttga acatagacta      6240
     aatagtattc atattaaata ttatttttat aattatataa atattaataa tgatgaatta      6300
     agtaaattat ataataatta tataataagt attaataatc aaataattaa tttattaaat      6360
     aatgataata atagtttaaa taatttaata cttaaatatt ataataaaaa agtttatatt      6420
     aatctttata aattaaatta tatatattta gatctagaat tattaagtca actattaact      6480
     aatatctata ataataatgg tttatcatta aaatcattaa agataattat taataaatta      6540
     ccatttaata atgatatatt attatcaaaa aattatgtta ataaaataaa taaatataat      6600
     ttactaatta ataataattt aaataataat aaaaaagatt taattaattt atatacttta      6660
     gataataaat tattagattt aagtattctt aataatatat tattaggtaa atatttagta      6720
     ggtagtaata tccaattaaa gggtagacta ttaaatagaa atattactag actaataaaa      6780
     ataaatatta tgaaaggtac atttaataat tatatatatc aatgaagtaa attaaataat      6840
     ttatataaat taaattatat atcacttaat attaataaac ttaataatct atttattaat      6900
     aaaaatggta tatttaatat taaaattaaa ttaaatacta tttaataaat attctataag      6960
     taatttctta tttattttat aacattttaa aatgttttat gttaaataga taataatcaa      7020
     ttaaataata aaaattaaga tgccacaaat aattccattt ttctttatga atcaattaac      7080
     ttatggtttt ctatttattt tactaatttt attcttacta tcttatgtat ttttacctat      7140
     gattttaaga ttatatatct ctagattata tatttctaaa ttataaatag ttaattaaaa      7200
     ttttaaatta agatctatta atgatcatta tattataaaa tataataaag aatatattta      7260
     aataataata ataatatgaa atattatatt aattctccat tggagcaatt tgagattaga      7320
     gatttattag gtttaacatc accaataata gattttagtt ttattaatat tactaatttt      7380
     ggtttatatc ttataattct tttattagta attttactaa tgaatttaat aactaataat      7440
     tataataaat tagtaggttc taattgatat ttaagtcaag aaataattta tgatactatt      7500
     ataaatatag ttaagacaca gattggtggt aaagtatgag gttattattt tccattagtt      7560
     tatacatttt ttattcttat ttttactata aatttaatta gtataattcc ttattcattt      7620
     gctataactt cacatgtagt atttgtagta tcaataagta taattatttg attaggtcta      7680
     actattattg gtttttatac tcatggttta aaattctttg gtttattttt accactaggt      7740
     acaccattaa ttttagtacc attattagta tcaattgaat tattatcata ttttgctaga      7800
     cttatttcat taggtttaag attatcagct aatattatag ctggtcattt attaattgtt      7860
     attttaggtg gtttattatt taatttaata gctataaata ttttaacatt tttattaggt      7920
     ttcttaccaa tgattgctat tttaggtatt gtatgtttag aatttgctat tcttattatt      7980
     caagcttatg tatgatgtat tttaatatca tcatatttaa aagatctaat ttatttacat      8040
     taattaataa ttaataatat ttaataatat tcaataattt atatatttta ttatatttaa      8100
     taattatata aatactttaa ttacataaat actttaatta gagagttagg gttcaccccc      8160
     ctaatgctta tcagcattat gaggtaccac tctaattaaa ggtaaatata tatatttaat      8220
     aataaaagga tatagtttaa ttggtaaaac tattgacttc aaatcaatca ttaagagttc      8280
     aaatcttttt atccttgtta tattttaata atataaatta ataaataata aatatgataa      8340
     atcataatat taaagatatt gattaatatt tttaattaat taaataatat gcaattagta      8400
     ttagcagcta aatatattgg tgcaggtatt tcaacaattg gtttattagg agcaggtatt      8460
     ggtattgcta ttgtatttgc agctttaatt caaggtgtat caagaaatcc atcaatgaaa      8520
     gatactttat tccaatttgc tattttaggt ttcgctatta gtgaagctac aggtttattc      8580
     tgtttaatga tttctttctt attattatat ggtgtttaat tttattaaat tatataataa      8640
     ttaatattca aaataagtta tattagctta attggtagag cattcgtttt gtaatcgaaa      8700
     ggttaggagt tcaaatctct tatgtaacaa tttaattaaa taaataaaga tcttatcgtc      8760
     taatggttac gacatcatct cttcatgttg aaaatatcgg ttcaattccg attaagatta      8820
     ttaatatatt ttaataatta ttataattaa caatattaat tagaggggta ccaacatatt      8880
     gctaactagc aataggggtg tgtaccttat ctctctaatt aataatttat aaattaaata      8940
     attaaataaa ttaaataatt aaataattaa atcttaatgg tttattaggt tcaattccta      9000
     taaagattat ataaatatta ataaataata aataataaat taatatatta attaaataat      9060
     ataatttatt ataaagaatt atattataat ctaatattta ttaaataata atttaataat      9120
     attttaataa taaaatatat ggcatataga aaatcaaatt tatatttaaa tttagttaat      9180
     agttatgtta ttgattcacc tcaaccatca tcaattaatt attgatgaaa tttaggttct      9240
     ttattaggtt tatgtttagt tattcaaatt cttactggta tttttttagc tatgcattat      9300
     tcatctaata ttgaattagc tttctcatca gtagaacata ttatgagaga tgtacaacta      9360
     ggttgattaa ttagatatat gcatcttaat ggtgcttcat tcttctttat ttgtatgtat      9420
     attcatattg gtaaaggttt atattatggt tcttataaat cacctagagt tattgtatga      9480
     acagttggtg ttattatctt tattttaact atagcagcag ctttcttagg ttattgttta      9540
     gtatatggac aaatgtcaca ttgaggtgct actgttatta ctaatttatt tagtgctatt      9600
     ccatttattg gaaatgatat tgtactatga ttatgaggat catttagtgt tagtaatcct      9660
     actattataa gattctttct atttcattat ttagtaccat ttattattgc agcaatagta      9720
     attatgcatt taatgctatt acatgtacat ggttcatcaa atccattagg tattacaggt      9780
     aatttagata gattaccaat gcatggttat tttattttta aagatttagt aacagtattt      9840
     gtatttataa ttttcttttc attatttgta ttcttttcac ctaatacttt aggacatcct      9900
     gataattata ttccaggtaa tcctttagta acaccagcat ctattgtacc tgaatgatat      9960
     ttattaccat tctatcttat tttaagatct attcctgata aattaggtgg tgttattact     10020
     atatttggtc ttattttagt tttattaata ttacctatta ctgatagatc tattattaga     10080
     ggtaatacat ttaaactatt atctaaattc ttcttcttct tatttattct taactttatc     10140
     ttattaggta aattaggtga atgtcatgtt gaagtaccat ttattttaat aggtcaaatt     10200
     tgtacattta tttattttgc ttatttctta atcttagtac ctattatttc tataattgaa     10260
     aatattttat tttatttact aaataaaaaa taataattaa ataaataata ataatattca     10320
     ttaaatactt taatattaat atttatatat tatacttctt tatcatttag gagggtacct     10380
     catattgctg actagcaata ggggggtgaa ccctacgcac ctaaatgata agagtttatc     10440
     attaaattat atactatata ttataagtaa attatcaaac catatataag gtatatatat     10500
     taagaaagtt tgactgagtg gtttaaagtg taatatttga gctattataa atctttatga     10560
     tttcataggt tcgaatccta taactttcgt attaaataat tatttaaaat aattaaaaat     10620
     agttaataat aatgagaaca tgatgttggt tcagattaag cgctaactaa ggacattaca     10680
     catgcgaatc aaacgttaat attattaatt aatagtatta ataagtggtg tactcgtgag     10740
     taaaaattaa gaataatgaa cttaaaattt aactaaatat taaataataa ataaagaata     10800
     atgtaataat tatttgtttt aagtcaagct tataatgatt taggtattag ttaattaaaa     10860
     aataataact agccaaaaat tcataattgt taattaaagt tagaacaatc acgttgattt     10920
     agaaattata atcaatatct atatgataca gcagtgggga atattggaca atgatcgaaa     10980
     gattgatcca gttacttagt agaatgataa aattaataaa tattatttat taatatttgg     11040
     ttaacaataa aattcaataa tttatttaaa taatgattaa ataatctcaa tataaaatta     11100
     ttaatataat gagatatata tttttaaaaa gaatatataa ttaaataatc ccaaccaaaa     11160
     tttgtgccag cagctgcggt aagacaaagg gggttagcgt taatcgtaat ggcttaaagg     11220
     gttcgtagaa tgattattta aaataataat tagaattaat aaaaataatt taagaattat     11280
     tcaagtaaag atgaaataat aattatatga ataagactta taaagtgaaa atttaaatta     11340
     tatattaatt gacattgagg aacgaaggct aaagtagcaa atcggattcg atacccgagt     11400
     agttttagca gtaaacaatg aatacctatt tattttttat taattaaaga ataaattaaa     11460
     tgaaaattaa agtattccgc ctgatgacta cgttagcaat aataaaaatc aaaacaatag     11520
     acggttacag acttaagcag tggaacatgt tatttaattc gataatcctc gataaatctt     11580
     accatttttt gaatatttaa ttataataat ttataattaa ttacaggcgt tacatagttg     11640
     tcttcagttc gtgctgcaaa gttttagaat ttatcataaa cgaacataac tctaaatatt     11700
     ttttattaat aaaatattaa ttaattattt aatgaataat taagaaaaga attaagacaa     11760
     atcattatga tccttataaa atgggcaata gacgtgttat aatataatat acaaaattat     11820
     aaataaatat ttaataaaat ataaaattaa taattaaagt attataataa ttaataaaat     11880
     tatttattaa taagtatgga tttttaactg aaatttgtta aaatgaaata agaattgcta     11940
     gtaatctatt aataagaaag taatggtgaa tactctaact gtttcgcact aatcactcat     12000
     cacgcgttga aacatataat taaataaaga atattaatta atttattaat tattaattat     12060
     tattaatatt atttaataaa tataataaat attttaattt aaattatgaa ttaatgcgaa     12120
     gttgaaatac agttactgta ggggaacctg cagtgggctt ataaatatct ttaatattcc     12180
     atttttataa aataaatata ttttttaata tattttataa taactataat taaatagtta     12240
     aaatttaaat tataatttaa taatttaata acttattaat tagagagtta gggtacatcc     12300
     cccctaatgc tatgcattat ggttggtacc actctaatta ataaactata ataaataaat     12360
     actaatattt tatatcaatt aaattataat tattttttat taatatttta atattattta     12420
     atgaaatata taaataaagt attataaatt taataataaa taagaaatga agagaatcga     12480
     actcttaata attaaatttg caatttaata gtttaaccat taaacaacat ttccttatta     12540
     atattattta atcaattaat taatatctta ttattaatta gaaggatagg gtacacaccc     12600
     ctaatgctta cgcattcttg tggtacccat ctaattaata atgtattatc atatcatatt     12660
     attttgataa aagattaaat aatattaatt tattacctaa aatataataa tatattatct     12720
     taatatttat attgatttat ttataatatt tatatatctt gattatatac attaatatta     12780
     tatcttaata tcttaatata attgaaataa gattaatagg atttgaacct atattggtac     12840
     cttatcaaag tactattcta accttttgaa ttataatctc tttatatata tttataaaat     12900
     atggaattaa tgagaattga actcatatta aatgcatgca aagcaatcat tttaccaatt     12960
     aaattataat ccctttattt aattatttag ttcttaatag gaatcgaacc tatatagttt     13020
     cattaacagt gaaatgcttt aaccattaag ctataaaaac ttttaatatt attaatgaag     13080
     agaataggaa ttgaacctat gaagaactat gtcattgagt ttacagctca acttcaatta     13140
     ccaacattga aaatctctcc ttatatttat tatattcata atatatatct atctaaaata     13200
     tttacttata ctatatcttt tagtatacta tatattttaa tataaatatt tatgataata     13260
     actaatagtt taattaatgg ggtaccacca ctaatagggg ggtgtgtacc ctacaccatt     13320
     aattaactat tttaattaat aattatttat tatttttttt aattattttt aatatttata     13380
     tttaaaaggg taaaatcttt gtataagtaa gttctaaaat tagaactaaa gtttaaataa     13440
     atttgaaata tttattataa agatttaaag ggacaattat ggataataat aactattaat     13500
     aataaggtta ctaataaata tattttataa taatatttta aaacctaagg taaaccatta     13560
     ttatatattt taaaaatata taaattatat taaactaagt gaactaaaac atttaattaa     13620
     cttaaggaat ataaatcaac agagatattg agagtatagg tgatagaaat cgatatagtc     13680
     aataagtatt atgttattaa ttaatgtaag aatataggat aacaaattct aagactaaat     13740
     attattaata agtttaaaga agtaccgtaa gggaaaatta tttaaatagt tgttctataa     13800
     gcaattatat atattatatt aaataatata aataatgtac cttttgtata atgggtcagc     13860
     aagtaattaa tattagcata atattaaaat aaaaaatgat attaaaaata atataaatat     13920
     ttaacaatgt taaaattaat taaaataaat taaatttagt taatattaat taacccgaaa     13980
     gcagatgatc ttactattat caaatgatta aaatatatat ttattatatt taaaatataa     14040
     taaaatataa aaacgattga acaggttaat gtagcaatat tatctgatga ataatggtaa     14100
     gtagagaaag tcaaatctga tttgcaaata gctggttttc tacgaaacat atgttagtat     14160
     gattatttaa atattagata tatatggtat agttattaat attatttagg gaataattat     14220
     ttattttatt aaaaatatta aatctcagaa tatattatta atctaaaatt aaatatttca     14280
     gattattagc gataaggtta ataatcaaaa gggaaacagc ccagactaat agataaagtt     14340
     cctaattctt aattaagtga aattaatatt taataaatat ataacaatta gttgatggtt     14400
     ttgataataa tcattcttta atgaacatgt aacaatgcac taattatttt ttataaaaaa     14460
     tatttattta aatcattatt tttaattaaa taatgtaaat aaaaaataca cggatctaaa     14520
     ttaataactg aatctttaga ttattattat taattaataa aataataata atggtagtag     14580
     aacatttaat gatataaaat ataattatta ttcaattata ttatttaaaa agaattaaat     14640
     agagaatgct gacatgagta acgaaaataa ggtataatcc ttatcaccta aagcataagg     14700
     tttaacaata aaagcggttc ttaagtaata tattaaaaaa tataatatga tagaaataat     14760
     ctaatatata aattaactta aataatgtct ttataaattt attaagttca agaaatattt     14820
     atgtataaaa taccgtaatg tagaccgact caggtatgtt agtagagtat atgaaggtga     14880
     attagataat taaaggaaag gaactcggca aaaatagctc tgacgttagt caataaagag     14940
     atattaatta aaataataat taataataag aacaaagttg tacaactgtt tactaaaaac     15000
     acaacacttt gcagaaacgt aagttaaagt ataaagtgtg aactctgctc catgataaaa     15060
     tataaaaatt aatattttaa taaagataat aataataaat tttattaaat agcagcctta     15120
     ttatgagggt tataatgtag cgaaattcat tgtccactaa ttatggtcct gcatgaatga     15180
     cgtaatgata caacaactgt ctctccttta atctaagtga aattgaaatc ttagtgaaga     15240
     tgctaagtat ttgtagaaag acgaaaagac cctttgcagc tttactgtaa ttagatagat     15300
     cgattaatta atattattat ttagttatat aaagtaatag attatatatt aatgaaatac     15360
     ttttttttaa tatttaatta tatcttatcc tttttaaata tttaatagat aattcttaaa     15420
     tatattttat ttttataaaa aaataaatta aggaaacaat ctctaattgg tagttttgat     15480
     ggggcgtcat tttcataaaa agtatctgaa taagtccatt aaataaatat taattaattt     15540
     aaataaagaa atatatatat taaatatata tgatattaaa aattattaaa taaattaatt     15600
     aataataatt aataatttta ataataaaat agataaaata atgtacagtt ttatatgtta     15660
     ataaaacata atataggata atatattaaa taaatataat ggtataactg tgctataatt     15720
     gtaataccta caagtagaac aataacgtaa gtttggcata atgaacaaaa tatacatatt     15780
     gtaatggtat ttgataacga ataaaagtta cgctagggat taattaatag tcccattaaa     15840
     ttgtgaaatt taattatcaa tatttaaata tattgagtaa attgggttaa ttgcaaagaa     15900
     ctcctaatat tattttataa taataaagga caatctgcag cgaagcttat aacaatcctt     15960
     tttataaagt tataagaacg ttcaacgact agatatatga gtaggattaa caataattat     16020
     atccacgaaa gcccaatatg tattaattaa taaataatac ataatgaaat agtctgaaca     16080
     ataatgagaa ttattgaaat aataattaaa tgttattatg ataacaaaat tgaacagggt     16140
     aatataacga tagagtagct attgtaagtt atgtttgcca cctcgatgtc gactcaacct     16200
     atcctcttgg ttgtaacagc taagtagggt ttgactgttc gtcaattaaa aggttacgtg     16260
     agttgggtta aatacgacgt gagtcagtat ggtttctatc ttctacaaat aatattatta     16320
     attaaagtct aactcttagt acgcaaggat cagagttatt aaacctatga tgtaactatt     16380
     gattatatta attaaatatt aaaataaata tatttaatca ttattaattt ataataaata     16440
     atataaacat agtagttaag ttaagtttaa aaataataaa tattgaaagc atataaaata     16500
     tgaagtagtc tttaataaat aattatattg ataattttat actaaaattt attaaatagg     16560
     ttatatatat aatataaatt attaatatta attattaata ttttataata atgtataata     16620
     ctaatttatc aataatcttt ataatatcaa atttatttaa actttaaacg tatcatttag     16680
     gtgtgtaggg ttcacccccc aatacctatc ggtatttgtt ggtaccctcc taaacgatac     16740
     tctaagtatt aatataatta tataacatag ttattaatat ataatatata taatatataa     16800
     atagttaata attaataata tctaaatatt aaattgaaat atcaaatatg atatgaaata     16860
     taaatattaa gtattaaata tgatatgaaa tattaaaata tattaaatat acattaattt     16920
     attatttgta tatttaattt ttaattaata aagttaaatt aagaattaat aatttattaa     16980
     tctaataata taataaatat ataaaatatt aacaatatta atattagtat ttaatataaa     17040
     tattaaaatt taatactaaa taatattaat ttgttaatta ttaataaagt atataaagta     17100
     ttaattattt aataatataa tttaataaag tctcatttag aaggttaggg tacatccccc     17160
     ctaatgctat gcattatggt tggtacccat ctaaatgctc ctagttatta tatatatata     17220
     ctttattatt attagttata tatccccccc tatacttata tatatatata ctatatcaat     17280
     aattaatttt aataattagt aataatagtt ataatatata tagtattaat ataaatagtt     17340
     aataataaat agttataata gtattaatat aaataatata taaatattag ttattattaa     17400
     atataatatt aagtattaat aatattagta gttaataaat aataatatat agtaattata     17460
     atagtattaa tatatagtta taatagtatt gatatagata gtagttatta ttaaatatga     17520
     tatattaagt attaataata ttggttatta atgataatat taagtattaa tgatataata     17580
     ttagtagtta ataaatagtt atagtatagt aataatatgg tatgtattaa ttattatatg     17640
     tagttataca tataagatta attaatatca tattagtaag taagtattaa taagtattag     17700
     taattattat taatattgta aataataatt taataaataa tataataaat agtaataata     17760
     agtatttaaa acatatcatt tagagagtta gggttcaccc ccctaatgct tatcagcatt     17820
     atgaggtacc actctaaatg atattagtat atagtattaa tatataaata taattagtat     17880
     atagtattaa tataataata tatatatata atatatagta ttaatataaa gtatatatat     17940
     ttaatataat atttagttat aatatataat taataatgta ttataaatag tattaatagt     18000
     aataatatgt aattaataat attaatatag tatagtaata ataatgttaa taaatatata     18060
     atagtatcaa tatatagtta tagttaataa taaataatat tgaattatag tattagtata     18120
     gaatatatag tattaatata aaatattagt aataattata tatataaata aatatataat     18180
     atattagtta attaatagta tttattaatt ttaactatca tttagaagga taaggtacac     18240
     acccctaatg cttacgcatt cttgtggtac ccatctaaat gatattagtt ttatatgtca     18300
     atataaaata ttaatatcat atatattaag tatataatat gttaataata attaattata     18360
     aattagataa ttaaatatta gaattataaa tattaaatag aaatattaaa tagtaatata     18420
     aaatatagat tatagatata gaatatgaaa atataaatat taaaatataa atattaaatt     18480
     atatatatag ttaaataatt aagtatatag taattataat aattatttta aattatttaa     18540
     ataataaata taaaattgat atgtaatgat tagattatta aatgatataa atggtggggc     18600
     gatcaattag tgatatatat taataacaga taaatatata aatattataa actattatat     18660
     aaaatataaa taatattaga tattatataa agtataaata ttatagtata tagtataggt     18720
     aatgcaagat agtgtaattg gtaacatata aggctcatgt ccttttgata tacgttcaac     18780
     tcgtattttt gcaataatta actattatta aataagttaa taattaataa tatataataa     18840
     tatatagtat atatgatata tagataatta atatataata gtatatagta ttaatattac     18900
     ttaattcccg acgtaattaa ttgataataa taataaagtg tacaataata tataattatt     18960
     ataactatta gatatataat aactattaga tatatataat atataataat atgtatatat     19020
     aattaataaa tataaaaggt atataggtaa tatgaaatat taaatataaa tattaaataa     19080
     gtaatattga tgtgtactta aataataagt aacaatatta cgattatata aagatagtta     19140
     agttaatata ctaacataat cataatatag aatacaataa ttaaatagac aatattaatc     19200
     atataatcat attaataaat tatcatacta atatttaaat aaatataaat gtatataaag     19260
     ttattaatag gtagattata aatataataa ttatgtatag taatatttaa aatattaata     19320
     aatcatatat aaaatatata attaaatata tataaattaa ttatcaaatt acattaagta     19380
     atcatgataa ttaataatat tgaatatata ataatataaa tatagtataa tataatataa     19440
     aatattgata attagttaat aaataagtta ataatatata ataatatgtt attaatagtt     19500
     aataatgata ataatactta attccgggta gttaataaca ttaaataata aatattaaga     19560
     ttacattatc atattaccat taagtaataa tgataattaa tattaagtat ataaatatat     19620
     atataatata tataataata tagtatataa taataattca ttattaataa tataatattc     19680
     aattatataa ttaaataata ataatataga atacataata tatagttaat agtatagtat     19740
     actaatatta attgattccc aacgggatga atattaataa taataaatat acttaatgat     19800
     atagattatt aatcaggtaa ccatatatta aatatgaaat atatgataat attagataat     19860
     tagtatagta taagattata tatattatag ttatatatag ataatattag tattatatag     19920
     tatagtatat atatgtaata gttaaatatg ataataatac ttaattcact acggggtgaa     19980
     tagttaatta aataattata attaatatca ttaataacaa tagttaataa tatattaatt     20040
     taatatatag agtattaata aatatagttt gtatatatta gtatttatat atatatattg     20100
     ataatatata atataatagt atagtattag tatattgtat ttaatagtta tatataataa     20160
     taaacttaat tccctacgga gttaataata taaatattaa ttatataatg tataatataa     20220
     agataatata gatataataa ttaatattaa ataagtatat ataatagttt aatataatta     20280
     ctaataagat tagtaaatta aagatatcag attattagtc aggtaaccaa ttatattaat     20340
     taaaatatat tataattaat attagattaa taatatatta attatagaat aaatatagat     20400
     atagtatatt aatagtatag tataataata atacttgatt ccctacggaa ttagtattaa     20460
     tataaaatta aattattaaa tatataatta gataactaat attataaagt attgtatata     20520
     tgattatata gtatagtatt aatatataat agttaaatat aataataaac ttaattccct     20580
     acgatgttaa tagtaagtaa tattattagt attcatatca ttaatataat tagataataa     20640
     ttgttatttg ttattaagta tatatatcat attatttgat atatagttat attagataaa     20700
     tatatatagt attaattaag taaatagtag agtatgtata tatattatta atagtataat     20760
     aagataatat taattgattc cctacggagt taatagttat taattattaa tttataatta     20820
     gagtatcaga attatagttt ggtaaccatt gttattaagt attatatgat atgatataat     20880
     aatatagtat tagtttatat tatataaatt agatatagat tagatatatt atttatattg     20940
     taatagatat atagagtata tagttataat agttaaatat gataatatta cttaattccc     21000
     tacgaagtta gtgaatatag ttaatattga ttatatatat attattaatt attgatatta     21060
     ttatcaggta acctattgtt tattaatata tagagtatat aataagtaga cattatagtt     21120
     attaatatta tttctaattt gtatatttat taattattaa ttgggtaact attgttatca     21180
     tttgataata ttgataagat attaatcaga ttattagttt gttaatctat tgttaataat     21240
     atagagatag atatagtata gatattatat attatatagt atagatattg tatataaatc     21300
     ttatagatat taattattca ttaatcattg atcaagtaat caatagttaa taatattaag     21360
     aatataatat gtagacattt agtctagtct attaattatt aattattttg taatttgttg     21420
     ttaatttgtt gatattttat tgattttgtt gacattttgt tgacatgttg atatgttata     21480
     aaatataatt taatattatt ttatataatt attattatta tctagtcata gactcatata     21540
     aatatgaata tattccatta ttaattgttt aggataaaca taaattaata taataactta     21600
     tttttaagtt caataaatat gttcatattt atatgattaa ttcataacgt attcgatata     21660
     aatatctcat acccttttat gaattaatta agcggtatta aattattctg attggattaa     21720
     gttattattt aatttatgtt cctaacaatt aattgattcc ataaatatcg atatttatta     21780
     ttatttatta aaatattaat gataatattg taatacttca attattttat caaatggcaa     21840
     gtaatctatt aatcatttaa tacgattgat aagaaagaaa agaatatcat ctatcgtata     21900
     atatatttca agtatgacct cttcaatata attagaagtt taaacttgta gagaattaag     21960
     aatttaatat gagtcttaca ttaatacttg atatgaatcc tttaatctac ttatttgttt     22020
     aaccgttgaa agagaagaat agttaatcta agtattacat tatatattga tataatagtt     22080
     ttatttaatt atttgtttat tcgttagata agaattaaac taatctattg tataatttaa     22140
     tttatatatg acctcttcaa tatacttaga agtttaacct tagaaggaaa taggacatta     22200
     atagaagtat tacattaata cttgatataa tagtttaatt aacttatttg tttatacgtg     22260
     gagaagggaa atacactaat ccattgtata atttaatatg agtatgacct ctttaataaa     22320
     cttagaggtt tatacttgta aggaattaag aatttaagat aagtcttaca ttaatatctg     22380
     atataatagt ttaatcttat tagaagttta tcgttgagag ataaagatag ttaatctatt     22440
     atataattta atattgatat gattccttaa tataattaga tatttaatct ttagttattt     22500
     ttaataattt aatttataaa aggtctttaa catattaatt agagcgttag ggttcacccc     22560
     cccaattccc taggggaata tggttggtac ccctctaatt aatatttaaa tatatcagcc     22620
     aaacattaat taatacctta ataataatat ttaagaatta ttatattaat cattattatt     22680
     acataatttt atatcaatta ttaattatga attataagaa ttagtattaa tagtttattt     22740
     agtttgtaca atttaatatc agttaacatt taatccaacg gtattataaa atatcaataa     22800
     attatattaa tcatattaat tcaatagata tatatattag ttagtattta atagataata     22860
     tataaacaat agttattata agatattata ttaatagttt attaagtctg tataatttaa     22920
     tcttagttag catttaatac aacggttaaa gattaagata tattaattat aattatttaa     22980
     taataagtta tataaattat attagttatt tattaatatt taattagata ttagtacatt     23040
     acatccatta tcatttagag gggtaccaca agaatgcgta agcattaggg gtgtgtacct     23100
     tatctctcta aatgatatga ttaattatta taacattctt tatttaatta ttattaaaat     23160
     attaaaatta ttaattatta ctttataaga ttatattatt taattattat gatatgagat     23220
     atttattagt tattagacat tcatagctta taccacaata aatattggtg ttatcaacat     23280
     ttattgggta gctattcatt aattattaag aaattgttaa tattagttat ttaaagatta     23340
     gtaatagata tttatattat ttattaatta gttatagatt gttaataaga tatattaaga     23400
     tatagtattt atatactaag atatatacat taggaacatt taggagggta ccaacaaata     23460
     ccgataggta ttgggggggt gaaccctaca cacctaaatg tgactattaa aaactattat     23520
     cattaattta gatactctca atttataagt taagtactta gatt                      23564
//

If you have problems or comments...

PBIL Back to PBIL home page