(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_8.PE1

ASHGO_8.PE1          Location/Qualifiers
FT   CDS_pept        660..1406
FT                   /codon_start=1
FT                   /gene_family="HOG000264988" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18080155"
FT                   /gene_name="COX2"
FT                   /gene_synonym="CoxII"
FT                   /locus_tag="AMI001W"
FT                   /orf_name="AgCOX2"
FT                   /product="Cytochrome c oxidase subunit 2 "
FT                   /EC_number="1.9.3.1"
FT                   /function="copper ion binding"
FT                   /function="cytochrome-c oxidase activity"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="AAS50168.1"
FT                   /db_xref="EMBL:AAP57840.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG316213"
FT                   /db_xref="HOGENOM:HBG390534"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR015964"
FT                   /db_xref="UniParc:UPI00002523BA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7YFV7"
FT                   /transl_table=3
FT                   /translation="MLLMNLFTIINNDVPTPYNMYFQDSTTPHQEGILELHDNIMFYML
FT                   TVLGLVSWMMIIIIKDYKNNPITYKYIKHGQMIEIIWTILPAIILLMIAFPSFILLYLC
FT                   DEVISPAMTIKVIGLQWYWKYEYSDFINDNGETIEYESYMIPEELLEEGQLRMLDTDTS
FT                   IVIPVDTHVRFIVTATDVIHDFAVPSLGIKIDTTPGRLSQVSTLIQREGIFYGQCSELC
FT                   GAQHSAMPIKIETVKLPTFLTWLNEQ"
     atgttattaa taaatttatt tcttatcatt aataatgatg tacctactcc atataatata        60
     tattttcaag attcactact acctcatcaa gaaggtattt tagaattaca tgataatatt       120
     atattctata tgttacttgt tttaggttta gtttcttgaa taataattat tattattaaa       180
     gattataaaa ataatcctat tctttataaa tatattaaac atggtcaaat aattgaaatt       240
     atttgaacta ttttaccagc tattatttta ttaataattg catttccatc atttatttta       300
     ttatatttat gtgatgaagt tatttcacca gctataacta ttaaagttat tggtttacaa       360
     tgatattgaa aatatgaata ctcagatttt attaatgata atggtgaaac tattgaatat       420
     gaatcttata taattcctga agaattatta gaagaaggtc aattaagaat gttagatact       480
     gatactagta ttgttattcc tgttgatact catgtaagat ttattgttac agctctagat       540
     gttattcatg attttgctgt accatcatta ggtattaaaa ttgatctaac accaggtaga       600
     ttaagtcaag tatcaacatt aattcaaaga gaaggtattt tttatggtca atgtagtgaa       660
     ttatgtggtg ctcaacatag tgctatgcct attaaaattg aactagttaa attaccacta       720
     ttcttacttt gattaaatga acaataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page