(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_8.PE2

ASHGO_8.PE2          Location/Qualifiers
FT   CDS_pept        1957..3564
FT                   /codon_start=1
FT                   /gene_family="HOG000085274" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15753602"
FT                   /gene_name="COX1"
FT                   /locus_tag="AMI002W"
FT                   /orf_name="AgCOX1"
FT                   /product="Cytochrome c oxidase subunit 1 "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="aerobic respiration"
FT                   /biological_process="electron transport chain"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="AAS50169.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0009060"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG411475"
FT                   /db_xref="HOGENOM:HBG603668"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="UniParc:UPI00002523BB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62514"
FT                   /transl_table=3
FT                   /translation="MYLQRWLFSTNAKDIAILYFIFSTFCGLAGTAMSFIIRMELSAPG
FT                   QQYLQGQNQLFNVLVTGHTILMVFFLVMPMLIGGFGNYYLPLMIGASDMSFARLNNISF
FT                   WTLPPTLICLLTSTMVESGTGTGWTVYPPLSSIQSHSGASVDLAIFSLHLTTISSLLGT
FT                   INFIVTALNMRTNGMTLHKMPLFTWSILITAVMLLMSLPVLSAGVTMLLMDRNFNTSFF
FT                   EVQGGGDPILYQHLFWFFGHPEVYIMIVPTFGMMSHIVSTYSKKPVFGEISMIYTMGSI
FT                   SLLGFLVWSHHMYVVGLDTDTRAYFTSATMIITIPTSIKVFSWLTTIYGGSLRLTTPML
FT                   YTLSFLFLFTVGGLTGVVLANTSLDVAFHDTYYVVTHFHYVLSLGAVFSMFAGYYYWSP
FT                   TVLGLNYNEKLSQIQFWLIFLGTNIIFFPMHFLGINGMPRRIPDYPDTFTGWNLVSSFG
FT                   SMMTIMSLMLFTYIIYDQLMNGLTNKVNNKSINYMKTPDFIESNNIFLMNTTKSSSIEF
FT                   MLNSPPTIHSFNTPTIQS"
     atgtatttac agagatgatt attttctaca aatgctaaag atattgctat tttatatttt        60
     atttttagta cattttgtgg attagcaggt acagctatat catttattat tagaatagaa       120
     ttatcagcac ctggtcaaca atatttacaa ggtcaaaatc aattatttaa tgtattagtt       180
     actggacatc ttattttaat agtattcttt ttagtaatac ctatattaat tggtggtttt       240
     ggtaattatt atttaccatt aataattggt gcttctgata tatcatttgc tagattaaat       300
     aatatttcat tttgactatt accaccacta ttaatttgtt tattaacatc tactatagtt       360
     gaatctggtc taggtactgg ttgaactgtt tatcctcctt tatcttctat tcaatcacat       420
     tctggtgctt ctgttgattt agctattttc tctttacatt taactactat ttcttcatta       480
     ttaggactta ttaattttat tgttacagct ttaaatataa gaactaatgg tataacttta       540
     cataaaatac ctttatttct atgatcaatt ttaattactg ctgttatatt attaatatca       600
     ttaccagtat tatcagctgg tgttactata ttattaatag atagaaattt taatacatca       660
     ttctttgaag tacaaggtgg tggtgatcct attttatatc aacatttatt ttgattcttt       720
     ggtcatcctg aagtatatat tataattgta ccactatttg gtataatatc acatattgta       780
     tcaacttatt ctaaaaaacc tgtatttggt gaaatttcta taatttatct aataggttct       840
     attagtttat taggtttctt agtttgatct catcatatgt atgtagtagg tttagatctt       900
     gatactagag cttattttac ttcagctact ataattattc ttattcctac tagtattaaa       960
     gtatttagtt gattactaac tatttatggt ggttcattaa gattactaac accaatatta      1020
     tatctattat catttttatt tttatttact gtaggtggtt taactggtgt agtattagct      1080
     aatctatcat tagatgtagc attccatgat acttattatg tagtactaca tttccattat      1140
     gtattaagtt taggtgctgt attctctatg tttgctggtt attattattg aagtcctctt      1200
     gttttaggtt taaattataa tgaaaaatta tcacaaattc aattctgatt aattttctta      1260
     ggtcttaata ttattttctt ccctatgcat ttcttaggta ttaatggtat accaagaaga      1320
     attcctgatt atcctgatct attcctaggt tgaaatttag tatcttcatt tggttctata      1380
     ataactatta tatcattaat gttattcctt tatattattt atgatcaatt aataaatggt      1440
     ttaactaata aagttaataa taaatctatt aattatataa aactacctga ttttattgaa      1500
     tcaaataata ttttcttaat gaatactact aaatcatcat ctattgagtt tatattaaat      1560
     tcaccacctc ttattcattc atttaatact cctctaattc aatcttaa                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page