(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_8.PE7

ASHGO_8.PE7          Location/Qualifiers
FT   CDS_pept        8389..8619
FT                   /codon_start=1
FT                   /gene_family="HOG000235245" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20623378"
FT                   /gene_name="ATP9"
FT                   /locus_tag="AMI007W"
FT                   /orf_name="AgATP9"
FT                   /product="ATP synthase subunit 9, mitochondrial "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /function="lipid binding"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="AAS50174.1"
FT                   /db_xref="GO:0008289"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG514500"
FT                   /db_xref="HOGENOM:HBG753983"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniParc:UPI00002523C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75G38"
FT                   /transl_table=3
FT                   /translation="MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALIQGVSRNPSMKD
FT                   TLFQFAILGFAISEATGLFCLMISFLLLYGV"
     atgcaattag tattagcagc taaatatatt ggtgcaggta tttcaacaat tggtttatta        60
     ggagcaggta ttggtattgc tattgtattt gcagctttaa ttcaaggtgt atcaagaaat       120
     ccatcaatga aagatacttt attccaattt gctattttag gtttcgctat tagtgaagct       180
     acaggtttat tctgtttaat gatttctttc ttattattat atggtgttta a                231
//

If you have problems or comments...

PBIL Back to PBIL home page