(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1

ID   ASPNC_1; SV 1; linear; genomic DNA; GRV; FUN; 3625813 BP.
XX
AC   AM270980_GR;
XX
DT   12-MAY-2009 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Aspergillus niger (strain CBS 513.88 / FGSC A1513) chromosome 2R,
DE   complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus niger (strain CBS 513.88 / FGSC A1513)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; mitosporic Trichocomaceae;
OC   Aspergillus.
XX
RN   [1]
RX   PUBMED; 17259976.
RA   Pel H.J., de Winde J.H., Archer D.B., Dyer P.S., Hofmann G., Schaap P.J.,
RA   Turner G., de Vries R.P., Albang R., Albermann K., Andersen M.R.,
RA   Bendtsen J.D., Benen J.A.E., van den Berg M., Breestraat S., Caddick M.
RA   X., Contreras R., Cornell M., Coutinho P.M., Danchin E.G.J., Debets A.J.
RA   M., Dekker P., van Dijck P.W.M., van Dijk A., Dijkhuizen L., Driessen A.J.
RA   M., d'Enfert C., Geysens S., Goosen C., Groot G.S.P., de Groot P.W.J.,
RA   Guillemette T., Henrissat B., Herweijer M., van den Hombergh J.P.T.W.,
RA   van den Hondel C.A.M.J.J., van der Heijden R.T.J.M., van der Kaaij R.M.,
RA   Klis F.M., Kools H.J., Kubicek C.P., van Kuyk P.A., Lauber J., Lu X., van
RA   der Maarel M.J.E.C., Meulenberg R., Menke H., Mortimer M.A., Nielsen J.,
RA   Oliver S.G., Olsthoorn M., Pal K., van Peij N.N.M.E., Ram A.F.J., Rinas
RA   U., Roubos J.A., Sagt C.M.J., Schmoll M., Sun J., Ussery D., Varga J.,
RA   Vervecken W., van de Vondervoort P.J.J., Wedler H., Woesten H.A.B., Zeng
RA   A.-P., van Ooyen A.J.J., Visser J., Stam H.
RT   "Genome sequencing and analysis of the versatile cell factory Aspergillus
RT   niger CBS 513.88.";
RL   Nat. Biotechnol. 25:221-231(2007).
XX
CC   This Genome Reviews entry was created from entry AM270980.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3625813
FT                   /organism="Aspergillus niger"
FT                   /strain="CBS 513.88 = FGSC A1513"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 2R"
FT                   /db_xref="taxon:425011"
FT   CDS_pept        join(<134..282,484..700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959383"
FT                   /orf_name="An01g00010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36846.1"
FT                   /db_xref="UniParc:UPI0000EF9E97"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B1"
FT                   /transl_table=1
FT                   /translation="PPTFQLQLSTVEADPPRVKQIGNDNKPISRDKNGALVKHEGVSEH
FT                   SADFIVSMTEKSAFMIFMIDLLNANRHLRLAGGIGKEQVALNIRGVTTSEPIQRWSHLL
FT                   FISALVSVSSRDLLVCI"
FT   CDS_pept        join(1295..1387,1687..1968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874675"
FT                   /orf_name="An01g00020"
FT                   /protein_id="CAK36847.1"
FT                   /db_xref="InterPro:IPR022085"
FT                   /db_xref="UniParc:UPI0000EF9E98"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B2"
FT                   /transl_table=1
FT                   /translation="MQQYSEALLASLPEGGNEQVPVNAAGLGWEEKGLPFSVLDMVEFW
FT                   INGFVTMSGTQRLNLSSFAKVASTRDYMDGLCQIAPFLFRATLENENRDLRSVNESDAE
FT                   DPIRAMNRLSMVDVLAEAAP"
FT   CDS_pept        join(2871..2891,2969..3014,3129..3232,3310..3423,3
FT                   481..4272)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874676"
FT                   /orf_name="An01g00030"
FT                   /product="Function: Disruption of S. cerevisiae HGH1
FT                   reveals no basic phenotypes"
FT                   /function="binding"
FT                   /protein_id="CAK36848.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG329863"
FT                   /db_xref="InterPro:IPR007205"
FT                   /db_xref="InterPro:IPR007206"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000EF9E99"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B3"
FT                   /transl_table=1
FT                   /translation="MPTELEELVEFLHHGNTPIRQIACENLVGFSVSQPELFKRHQLLP
FT                   VRDLKLLVRDYTPIAKNAITILINLSADEEVLAALAEDDAFVETLLVKLANVKEPNADD
FT                   VAMLFANLAKSEKMKKLFTLKRKVPEGVSSSANAIDQLMDCFVKGAEGALNKHANFDYL
FT                   SYLFADLSKYEEGRAYFTTKQEYDDVVPVTKLTVFTEHTSGIRRKGVASTIKNVAFDLP
FT                   FHPKLLSEDEADILPYILLPIMGPEEYDEEESMDMLPDLQLLPPDKQRDSDTSIIVTHL
FT                   ETLLLLTTTREGRDKMRAIKVYPIIRECHLHVDDDAVREACDRLVQVLMRDEEGEEKPH
FT                   PPIDRNAYDDDQKVEELF"
FT   CDS_pept        5250..>6158
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874677"
FT                   /orf_name="An01g00040"
FT                   /product="Function: in S. cerevisiae TFIIF is required for
FT                   initiation at most"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36849.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI0000EF9E9A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B4"
FT                   /transl_table=1
FT                   /translation="MTTPTNDQTLKTPTGSNGPPPVRIRRPKVADPLVRPKRRPAIRPP
FT                   APTSAANGASRMPNSRPVTSSQLPGARVEKSLNPKNDFSANGFSGPLLSENYVDYPIVT
FT                   TRRALREGLKHHIARFTSKKSVDPRDESQFTRPVRLQRRDPRARPNEAHVERGQLNSKP
FT                   GSEQSTQMDELEREELEARKAAREKERAENMAQIAPSVGSAPKRHNAPKQKTQQVTKTD
FT                   MTPEEIARTRIKYEEALPWHLEDFDNKNIWVGNYEAALSETHAVFVLENTGKMRMIPVE
FT                   KWYRFSAKNTFKALTIEEAERL"
FT   gap             6162..6261
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(<6263..9904)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874678"
FT                   /orf_name="An01g00050"
FT                   /function="fatty acid synthase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="fatty acid synthase complex "
FT                   /protein_id="CAK36856.1"
FT                   /db_xref="GO:0004312"
FT                   /db_xref="GO:0005835"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG736477"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR013565"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0000EF9EBC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B5"
FT                   /transl_table=1
FT                   /translation="MYGTSTGPQTGINTPRSSQSLRPLILTHGSLEFSFLVPTSLHFHA
FT                   SQLKDTFTASLPQPTDELAQDDEPSSVPELVARYIGHVAHEVEEGEDDASGTYVDVLKL
FT                   ALNEFERAFMRGNDVHAVAASLPGITAKKVTVVQAYYAGRTAVGRPLKPYDSALFRAAS
FT                   EEKASIYSVFGGQGNIEEYFDELREIYTTYPSFVDDLITSSAELLQSLSHEPEASKLYS
FT                   KGLDIMQWLQDRDSQPDTDYLVSAPVSLPLIGLVQLAHFVVTCKVLGKTPGELLERFSG
FT                   TTGHSQGVVTAAAIASASTWESFDKAAKNALTMLFWIGLRSQQAYPRTSIAPSVLQDSI
FT                   ENGEGTPTPMLSIRDLPRSAVQEHIDTTNQHLPEDRHISISLVNSARNFVVTGPPLSLY
FT                   GLNLRLRKVKALTGLDQNRVPYTQRKVRFVNRFLPITAPFHSQYLYPAYDRILEDLEDI
FT                   EIPAESLAIPVFDTKSGSDLSKSGEANVVPALVRMITHDAVNWEQATVFSGATHIVDFG
FT                   PGGISGLGVLTNRNKDGTGVRVVLAGAMDGTNAEVGYKPELFDRDEQSVQYAIDWVKEY
FT                   GPRLVKNAVGQTFVDTKMSRLLGIPPIMVAGMTPTTVPWDFVAATMNAGYHIELAGGGY
FT                   YNAKSMTEAVNKIEKAIPPGRGITINLIYVNPRAMAWQIPLIGRLRAEGVPIEGLTIGA
FT                   GVPSIEVANEYIETLGIKHIAFKPGSVDAIQQVINIAKANPKFPIILQWTGGRGGGHHS
FT                   FEDFHQPILQMYSRIRRCENIVLVAGSGFGGSEDTYPYLSGTWSSGFGYPPMPFDGCLF
FT                   GSRMMISKEAHTSKNAKKAIAEAPGLDDKDWEKTYKGSAGGVVTVLSEMGEPIHKLATR
FT                   GVLFWHEMDQKIFKLDKAKRVPELKKLRNYIIQKLNDDFQKVWFGRNAAGETVDLEDMT
FT                   YTEVVHRMVDLMYVKHESRWIDESLKKLTGDFIRRVEERFTTTEGQPSLLQNYSELNTP
FT                   YPAIDNILASYPEAASQLINAQDVQHFLLLCQRRGQKPVPFVPSLDENFEYWFKKDSLW
FT                   QSEDLEAVVGQDVGRTCILQGPMAAKFSNIIDEPVADILNGIHQGHIESLIKDVYGGDN
FT                   SGVPVIEYFGGRFQQEVDDSDIDGLTISEDANKVSYRLSSSPTADLPDLDRWLRLLAGP
FT                   SYSWRHAMFLADVFVQGHRFQTNPMKRIVAPVPGMYVEVSFPDDPSKT"
FT   CDS_pept        join(12561..13089,13163..18111,18171..18281)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959384"
FT                   /orf_name="An01g00060"
FT                   /product="Catalytic activity: Acetyl-CoA + n Malonyl-CoA +
FT                   2n NADPH "
FT                   /function="fatty-acyl-CoA synthase activity"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK36857.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004321"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG325769"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniParc:UPI0000EF9EBD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B6"
FT                   /transl_table=1
FT                   /translation="MRPEIEQELAHTLLVELLAYQFASPVRWIETQDVILAEKRTERIV
FT                   EIGPADTLGGMARRTLASKYEAYDAATSVQRQILCYNKDAKEIYYDVDPVEEEEAQPSA
FT                   EAAASAPAAAPAGAPAVAAAPAAAPPPSAGPAAAIEDAPVTAVDVLRTLVAQKLKKSLS
FT                   DVPLSKAIKDLVGGKSTLQNEILGDLGKEFGSTPEKPEDTPLDELGASMQATFNGQLGK
FT                   QSSSLIARLVSSKMPGGFNITAVRKYLETRWGLGSGRQDGVLLLALTMEPPSRIGSEAE
FT                   AKSYLDDVANKYAASAGISLSAPAAGGDSGAGGGGMLMDPAAIDALTKDQRALFKQQLE
FT                   IIARYLKMDLRAGQKAYITSQESQKTLQAQLDLWQAEHGDFYASGIEPAFDALKARVYD
FT                   SSWNWARQDALSMYYDIIFGRLKVVDREIVSQCIRIMNRSNPLLLEFMQYHIDNCPTDR
FT                   GETYQLAKELGEQLIENCKEVLGVAPVYKDVAVPTGPQTTVDARGNIGYKEVPRASARK
FT                   LEHYVKQMAEGGPISEYSNRTKVQNDLRSVYKLIRRQHRLSKSSQLQFNALYKEVIRAL
FT                   SMNENQIMPQENGSGKKTGRNGVKRNGSPRAGKVETIPFLHLKKKSEHGWDYNKKLTGI
FT                   YLDVLESAARSGLTFQGKNVLMTGAGAGSIGAEVLQGLISGGAKVVVTTSRYSREVTEY
FT                   YQAMYARYGGRGSQLVVVPFNQGSKQDVEALVDYIYDSKKGLGWDLDFVVPFAAIPENG
FT                   REIDSIDSKSELAHRIMLTNLLRLLGCIKTQKQSNGFETRPAQVILPLSPNHGTFGNDG
FT                   LYSESKLALETLFNRWYSENWNNYLTICGAVIGWTRGTGLMSGNNMVAEGVEKLGVRTF
FT                   SQQEMAFNLLGLMAPAIVNLCQLDPVWADLNGGLQFIPDLKDLMTKLRTEIMETSDVRQ
FT                   AVIKETAIENKVVNGEDSEVLYKRVIAEPRANIKFQFPNLPNWEEDVKPLNDNLKGMVN
FT                   LDKVVVVTGFSEVGPWGNSRTRWEMEAYGKFSLEGCVEMAWIMGLIKHHNGPLKGKAYS
FT                   GWVDAKSGEPVDDKDVKPKYEKFILEHSGIRLIEPELFKGYDPKKKQLLQEIVIQEDLD
FT                   PFEASKETAEEFKREHGEKVEIFELPESGEYTVRLKKGATLLIPKALQFDRLVAGQIPT
FT                   GWDAKRYGIPDDIIEQVDPVTLFVLVCTAESLLSAGITDPYEFYKYVHLSEVGNCIGSG
FT                   IGGTHALRGMYKDRYLDKPLQKDILQESFINTMSAWVNMLLLSSTGPIKTPVGACATAV
FT                   ESVDIGYETIVEGKARVCFVGGFDDFQEEGSYEFANMKATSNAEDEFAHGRTPQEMSRP
FT                   TTTTRAGFMESQGCGMQLIMSAQLALDMGVPIYGIIALTTTATDKIGRSVPAPGQGVLT
FT                   TARENPGKFPSPLLDIKYRRRQLDLRKKQIKEWQESELLYLQEEAEAMKAQASDDSFDV
FT                   SGYLQERAQHIEREAIRQEKDAQYSLGNNFWKQDSRIAPLRGALATWGLTVDDIGVASF
FT                   HGTSTVANDKNESDVICQQMKHLGRKKGNALLGIFQKYLTGHPKGAAGAWMFNGCLQVL
FT                   ESGLVPGNRNADNVDKVMEKFDYIVYPSRSIQTDGINAFSVTSFGFGQKGAQVIGIHPK
FT                   YLYATLDRAQYQTYKAKVEARQKKAYRFFHNGLINNSIFVAKDKAPYEDAQQSKVFLNP
FT                   DYRVAADKKTSQLKFPAQPPKANDKGLESTKTMIESLAKANASEDSKVGVDVENIESFN
FT                   IENETFIERNFTASEQEYCQKAASPRSSFAGRWSAKEAVFKALGVSSKGAGAPLKDIEI
FT                   SSDSTGAPVVNLHGAAAEAAKQAGVKQVSVSISHSDTQAVAVAVSKF"
FT   CDS_pept        join(complement(20214..20794),complement(19477..20168),
FT                   complement(19125..19374),complement(18722..18857))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874679"
FT                   /orf_name="An01g00070"
FT                   /EC_number="2.1.1.32"
FT                   /function="RNA binding"
FT                   /function="tRNA (guanine-N2-)-methyltransferase activity "
FT                   /protein_id="CAK36858.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004809"
FT                   /db_xref="HOGENOM:HBG386594"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="UniParc:UPI0000EF9EBE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B7"
FT                   /transl_table=1
FT                   /translation="MAEQLIQYDGTEYRAVKEGLAYILNPPAQAPGTKRDRKADEQSQS
FT                   VFYNPIQQFNRDLSVLAIRAYGEHLLALKKQKAEKKKQKAAANDSAKGKKRKREEVDGK
FT                   EQTQDQNQGQGDQTAAQQAEQDTAPSFTILDALSATGLRALRYASEIPFTSCVVANDLS
FT                   PSAIESMKTNIKYNSLGEKIRPNTGDARSYIHLGKFDVIDLDPYGSAAPFMDAAVQGVK
FT                   DGGLLCVTCTDAGVWASYGYPEKSFALYGGIPVKGPHCHEGGLRLILHGLAASAAKYGL
FT                   AIEPLLSLSIDFYARVFVRVHRSPAEVKYISGNMMMVYNCDAGCGAWSTQPITQTKQKL
FT                   DKKGNPFYHFGFAQGPVADSRCGHCGSRTHLSGPMWAGPLHNAQFIRRILDMLPQADRN
FT                   VYHTIDRIEGMLTTAMEEDLNLGISKYPFYFSLSALSKVLHTSTISIDAMRGAIRHLGY
FT                   RSTRSHARPNTIRTDAPWEVIWEIMREWVRQKSPIREGALKPGSPGAVIIPHPSTLEVV
FT                   FDEALGRETAKKRLVRYQINPRENWGPLSRASGGK"
FT   CDS_pept        join(complement(22133..22367),complement(21259..22046))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874680"
FT                   /orf_name="An01g00080"
FT                   /product="Similarity to hypothetical membrane protein
FT                   YOR228c - Saccharomyces cerevisiae "
FT                   /protein_id="CAK36859.1"
FT                   /db_xref="HOGENOM:HBG330174"
FT                   /db_xref="InterPro:IPR012472"
FT                   /db_xref="UniParc:UPI0000EF9EBF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B8"
FT                   /transl_table=1
FT                   /translation="MAASKESMPSKPEDIETRSIFSMQELDPSPVQDEFPDLESGDYFP
FT                   REPSPPSAREPIAGGGRFSSLKLGLRGHSWDSWLSAFQRYSTYPPTLFFALHWANTSLI
FT                   PLATRSVPDSESFLLLTRPVYQSPGLEHLVLTAPVLIHIASGIALRNIRSARRARLYGA
FT                   ETRSQRHSLTFWPRMSLQARLGYSLVPLLGVHVLVNRITPLMVDGGSSGVGLGYVAHGF
FT                   ARAPALWNLYYLLFVAVGVWHFVGGWAAWMGWRVTTVRKERDRKKGSLEGYLGASESEQ
FT                   RLRRQRKMWWTVNGIAAVGASIWLAGALGIIGRTGQGYGWEAKGWNEIYSQVPVIGSWL
FT                   "
FT   CDS_pept        join(22991..23035,23124..23744)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217774" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874681"
FT                   /orf_name="An01g00090"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK36860.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG330212"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI0000EF9EC0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B9"
FT                   /transl_table=1
FT                   /translation="MRLYIQRGFTNPTPKTESARSALSSFTCTLCNKSYSRHPEYEAHI
FT                   SSYDHQHRKRLQDLKQLSRDPNAAEKARRAERKADAEAGLRVLDTPKAASLSTTGTGSG
FT                   VGSSTGGGGGFKKGGFKSSFTTVKGPVAPAAPTKKNVLGGDDEDSELPEADDESLRRAR
FT                   SQSSKRENMQVDQAESDTDEEYDRNRGMNGGYYNPRNPTGCSPACAGARNVPLETSFI"
FT   CDS_pept        join(complement(25393..25634),complement(25197..25320),
FT                   complement(24810..25096),complement(24270..24741))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874682"
FT                   /orf_name="An01g00100"
FT                   /product="Catalytic activity: Pyruvate + lipoamide  "
FT                   /function="catalytic activity"
FT                   /protein_id="CAK36861.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI0000EF9EC1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C0"
FT                   /transl_table=1
FT                   /translation="MAAPRLFRPAARLLSSRLTSAPLRPQTACAPSILRFRGYATESGT
FT                   KEVTVRDALNEALAEELESNKKTFILGEEVAQYNGAYKVTRGLLDRFGPKRVIDTPITE
FT                   AGFCGLAVGAALAGLHPICEFMTFNFAMQAIDHVINSAAKTHYMSGGIQPCNITFRGPN
FT                   GFAAGVAAQHSQDYSAWYGSIPGLKVVAPWSSEDAKGLLKAAIRDPNPVVVLENELLYG
FT                   QAFPMSEAAQKDDFVLPIGKAKIERPGKDLTIVTLSRCVGHSLNAAAQLKQKYGVDAEV
FT                   INLRSVKPLDVETIIQSLKKTGRIMCVESGFPMFGVSSEILALSMEYGFDYLTAPAVRV
FT                   TGAEVPTPYAVGLENMSFPQEDTIVSQAAKLLRL"
FT   mat_peptide     join(complement(25393..25547),complement(25197..25320),
FT                   complement(24810..25096),complement(24273..24741))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C0 "
FT   mat_peptide     join(complement(25393..25394),complement(25197..25320),
FT                   complement(24810..25096),complement(24273..24741))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C0 "
FT   sig_peptide     complement(25548..25634)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C0 "
FT   CDS_pept        join(26335..26528,26592..27842,27960..28281,28347..28373)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110310"
FT                   /orf_name="An01g00110"
FT                   /product="Similarity to hypothetical protein SPAC1039.02 -
FT                   Schizosaccharomyces pombe"
FT                   /function="hydrolase activity"
FT                   /biological_process="nucleotide catabolic process "
FT                   /protein_id="CAK36862.1"
FT                   /db_xref="GO:0009166"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG736951"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="UniParc:UPI0000EF9EC2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C1"
FT                   /transl_table=1
FT                   /translation="MSSNYYLLFSASVTFLLFFLSPFVRAVQPTAPEPIEAPLRDLKWG
FT                   QLNFLHTTDTHGWLAGHLQEPSYSADWGDYISFATRMREKAESMGVDLLVIDTGDRVEG
FT                   NGLYDSSDPKGIYISKILREQHIDLMSSGNHELYKESTASAEFFTTTLNFAGHYLASNI
FT                   DFYDPRTNAFRPLAPRFTKIVTKQLGIRIVAFGFLFDFKGNANNTVVRPVGETIKEAWF
FT                   QEAIRDHEVDLFLVIGHAPVHSEEYWDIWREIRSLRWSTPIQFFGGHYHIRDYAKYDRM
FT                   SYGLASGRFMETIGFMSISGLSTHRQPGQSALASSLWPWDRFHFNRKYIDNNLLSFYHH
FT                   TGLNETTFPTEHGQNVSRLIQESRSALQLDEVYGCAPHDLFMSRAKYPGEGNIYTWLET
FT                   EVLPLSVRDVSRAGKPAVVIVNTGAIRFDIFKGPFTKDNTYIVSPFTSGFRYVKDIPYS
FT                   RAYYLADVLNRGPGILTEGPQLDNGYAEPDLIPGYTTHDDGGNDGDDTIHSPIDFFRVP
FT                   NVIRGTPRWDASEPPETVDLVYIDFIESNVAAVAPFAGINADFSRDSDVYMPNTTLTGL
FT                   IMDWIKGNWPCEETTNGLLFS"
FT   sig_peptide     26335..26412
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C1 "
FT   mat_peptide     join(26413..26528,26592..27842,27960..28281,28347..28370)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C1 "
FT   CDS_pept        join(complement(29720..29949),complement(28614..29636),
FT                   complement(28504..28537))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294683" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874683"
FT                   /orf_name="An01g00120"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK36863.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9EC3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C2"
FT                   /transl_table=1
FT                   /translation="MISGGMIRSAVRASGSHTACSIRIGAASQLASVSKRQLRGLYPDT
FT                   QVGDRRWISVYGYTQSKALIYSRYGEPKDVLQLHKHSISAPHGTQVNLRLLAAPLNPAD
FT                   VNQIQGVYPSKPPFQSTLGTQEPAAVAGNEGAFEVLSTGSGVKTLSKGDWVVMKQTGQG
FT                   TWRTHAQLDESQLIKIENKDGLTPLQISTVSVNPVTAYRMIKDFCDWDWMRAGEHWLIQ
FT                   NGANSGVGRAAIQLAREWGIKTLNVVRERKTPEETEALKKELTDLGATAVVTEAELLSG
FT                   EFRNVVHELTRKGQEPIRLALNCVGGKSATALAKTLAPGSHLVTYGAMSKQPVSLPSGL
FT                   LIFKNLVFDGFWVSKWGDKNPQLKENTINDVLQLTRAGRFKDIPVEEFKWKWDTEGSEL
FT                   VAGVQETLSGYRSGKGLLSTLSWLSNDFG"
FT   CDS_pept        join(30454..30592,30664..30988,31065..31240,31314..32188)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000116699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110311"
FT                   /orf_name="An01g00130"
FT                   /function="glutaminyl-tRNA synthase (glutamine-hydrolyzing)
FT                   activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAK36864.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0050567"
FT                   /db_xref="HOGENOM:HBG481888"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI0000EF9EC4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C3"
FT                   /transl_table=1
FT                   /translation="MSLLREAEKCLANQGSHAALNALITTLHQSGQWLERVRDADARRT
FT                   RGTPKSEIDGRLVAVKDNMCTRDLPTTCASNALDKFVSPFNATVVQQLEDAGAVVAGKA
FT                   NLDEFGMGSHSIHSNFGPVRSSRRGQDAEYLSAGGSSGGSAVAVATAQCYAALGTDTGG
FT                   SVRLPAAYTGTVGFKPSYGLVSRWGVVAYANSLDTVGVLGRDVASVRHVFGVVNQHDSR
FT                   DPTNLSPSSRSRIDSHLKMSALASRTSSPLRIGVPLEYNISELSPSARHAWSRSLAYLQ
FT                   RQGHSIQTVSLPTTKLALSAYYVLAPAEASSNLAKYDGVRYGSRPEAPDGNASSERYLY
FT                   AKTRGDGFGSEVKRRILLGAFSLSADAMDNYFIQAQRVRRLVQHDFNAAFRACQPLISS
FT                   QLGSKSGSADTGVDVLICPTAPSSPPRISSLIGPDATTSPLEAYTNDVFTVPASLAGLP
FT                   AISVPVTTENADGAEDGDLAGIQVIGQYGDDELVLKVAELLEGRHL"
FT   CDS_pept        complement(32574..34196)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178007" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874684"
FT                   /orf_name="An01g00140"
FT                   /product="Remark: Bre2 from S. cerevisiae is a subunit of a
FT                   complex associated with Set1"
FT                   /protein_id="CAK36865.1"
FT                   /db_xref="HOGENOM:HBG329723"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI0000EF9EC5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C8"
FT                   /transl_table=1
FT                   /translation="MPPKKRAVAVQNTALPSSDLSILRPLLLAEPRSSDLLPPQPRQLN
FT                   FVNRKTSDVIGQSWDFFEIVDKLTNKNGFRYSYAIADPSFPHIKYRQTDVQPYHARFSF
FT                   EDSPAAILFSKDALAVTSNEPWHTARANVCAREGSYYYEARIISGVVNNSPAPSSNSNG
FT                   GLPSRGHVRLGFARREGDLDANVGVDCYGYGIRDVNGEVVNRMRCEYFFPKGESIREGD
FT                   VVGLLITLPPLSLHKKVVEGTYESSADGEVSSPSSEAPSVTNIVRDRIPFHYKSDFCWQ
FT                   QSNVFPTKQLRDYAFNLKETPTFGPPSPFNAEDASLRTLPGSSITIFKNGVKMGTPFEE
FT                   LYAFLPPASRLANGTNNLGIGERENADDGMIGYYPAVSCYGGGAVECRFDGPWWVGPPS
FT                   HTDNGEPVRGIGERFNEQIVEDIVADIVDEVEAMCVWGGVDGNVVNNAKIDGSGTGAVG
FT                   GSEVLKGGVSAAYESAIPPVADGQSESAANPAGNGNEAGSVMDLDPGQAALEDATRADA
FT                   PVPEAPQNTIPDTSTGDGDVEMS"
FT   CDS_pept        join(35486..35854,35915..36162,36219..37083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178028" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874685"
FT                   /orf_name="An01g00150"
FT                   /protein_id="CAK36866.1"
FT                   /db_xref="HOGENOM:HBG738986"
FT                   /db_xref="InterPro:IPR007955"
FT                   /db_xref="UniParc:UPI0000EF9EEB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C9"
FT                   /transl_table=1
FT                   /translation="MPKATSSRSAAGRRHNPLAEDYMTAGHLRTQSAKKSSRKSRQEDE
FT                   QEDGERFVDAKMSRKILQIGQELADEDAEEQRATAGAAADKTNAAFDFESRLEGDEAFS
FT                   DDEKFQDDQWDDDEEIEEVEVDPDDLDMFNKFIPAGDEDPIFNPSGPEAEGQTRNLADL
FT                   ILEKIAEHEAKQGGESGGPFIQGGGLPEDAVQIPAKAVEVYEKVGMILSRYKSGPLPKP
FT                   FKILPSVPNWPTLLDITRPESWTANAVYAGTRIFISSKPAVAQEFISTVLLDRVREEIH
FT                   ETKKLNVHTYNALKKALYKPACFFKGLLFPLVSSGTCTLREAHIVSSVIARVSIPVLHS
FT                   AAALLRMCDLAAEQSLRSLESTGAVNMFIRVFLEKKYALPYKVIDALVFHFLRFRATDN
FT                   DAMMTDGSREANKVYKLPVLWHQSLLVFAQRYRNDITEDQREALLDLLLVRGHKDIGPE
FT                   VRRELLAGRGRGVVAPDPENQGAIDAGDDTMDVTL"
FT   CDS_pept        join(39100..39305,39370..39803,39824..40209)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234449" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110312"
FT                   /orf_name="An01g00160"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36867.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI0000EF9EEC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D0"
FT                   /transl_table=1
FT                   /translation="MEEAFSPVDSLAGSPTPELPLLTVSPADTSLDDSSVQAGETKAEE
FT                   KKPVKKRKSWGQELPVPKTNLPPRKRAKTEDEKEQRRIERVLRNRAAAQTSRERKRLEM
FT                   EKLENEKIQMEQQNQFLLQRLSQMEAENNRLNQQVAQLSAEVRGSRGNTPKPGSPVSAS
FT                   PTLTPTLFKQERDEIPLERIPFPTPSITDYSPTLRPSTLAESSDVTQHPAVSVAGLEGE
FT                   GSALSLFDVGSNPEPHAADDLAAPLSDDDFHRLFNVDSPVGSDSSVLEDGFAFDVLDGG
FT                   DLSAFPFDSMVDFDPESVGFEGIEPPHGLPDETSRQTSSVQPSLGASTSRCDGQGIAAG
FT                   C"
FT   CDS_pept        join(40931..40975,41097..41687)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874686"
FT                   /orf_name="An01g00170"
FT                   /product="Remark: RAD52 Inhibitor "
FT                   /biological_process="protein transport"
FT                   /protein_id="CAK36868.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG329774"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0000EF9EED"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C4"
FT                   /transl_table=1
FT                   /translation="MVRKDPIFEARTNVKLHSNRLKKEAARAEATFKSEKAKADKAMKN
FT                   REFQIARIHAASAVREKRRQVTLKAEAARADVIINELKAAQSTRDTSRTLALASRGLDA
FT                   ASKSVNLESLVSHANNFLARSEDFKIASSAIEDVAQGVSLQENGAEGEADVDRLMEQLA
FT                   DDAGVDLRMALEQDAAAAPKEEVKAPKQVDTELEDGLDARLRALRATN"
FT   tRNA            42338..42410
FT                   /gene_name="tRNA-Lys (CTT)"
FT   CDS_pept        join(42813..43555,43613..44137,44190..44328,44431..44462,
FT                   44516..44589,44657..45348)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874687"
FT                   /orf_name="An01g00190"
FT                   /product="Induction: priB transcript was abundant in
FT                   primordia"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36869.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329780"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9EEE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C5"
FT                   /transl_table=1
FT                   /translation="MDSSAALDPNKASHGRQAACLNCXKSKVRCNRGQDDASCSRCKQA
FT                   NVECIIPSHHVGRQKGVKKYALNALIFRGPQADMVKTSKRKGLEKALHQIEQAIKRPRS
FT                   NASGSEAAQKLISDLQEMLSNTREQQLHSEADDQSEDRSYTYHSPRDNNFGDNLSLDDA
FT                   ENPLQLLARASDLQLSPNEARDAHRWPPSTFPQPTGMLPSSTEGSDPAAQSYFVPIRAN
FT                   LDVGPDIDPIDIGLVTPSEAESLFSFFYQNLAHTRWGLDPLVHTVSFVRTQSAFLFTSI
FT                   MAAAALFLPSATALSKRLSRHCKSLAHNVIARRHRSVEIVLAFMVNVPWMEPGSCLGDD
FT                   DTCSYIAMALAVALDLSLNKIVLPSTSFEHSLLRRLAKAETIDAKRALYMDRFDGIEPN
FT                   SAWGRRLLRRRERTWIALFVLERGVCLARGRSYTVPSTALINYCDKWHVSDFADSRDGP
FT                   MNSMAVLRRNLVADAGSEVAQSIKNMIESFYDKWYEIWAPEIGEGHSRSLPPYVEILVT
FT                   HTRLSTYGGVINHPTAPLEVKRFFRAAGLSSALNVLRAAIQGESRLKSMPNNTVIMISF
FT                   AACSALSLSVMPEDSRSSLAPSVHNLIEETAGVLERIGATTRHRNGASVLYGRFLRALV
FT                   RRAPVSAGSQNLKVETGPLQPPPDLDGYCPVASGTQPSSIPTSFIWPEPLRFSAMSDDQ
FT                   IIDAVNRAGTAFGTSVPDVPLDDLMTWDWFDVGNAADFGF"
FT   CDS_pept        join(45640..45672,45864..46212,46278..46464,46521..46822,
FT                   46875..46954,47010..47041,47112..47229,47296..47517,
FT                   47601..47735)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806146"
FT                   /orf_name="An01g00200"
FT                   /product="Catalytic activity: succinyl-coa + a 3-oxo acid  "
FT                   /EC_number="2.8.3.5"
FT                   /function="3-oxoacid CoA-transferase activity"
FT                   /biological_process="ketone body catabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAK36870.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008260"
FT                   /db_xref="GO:0046952"
FT                   /db_xref="HOGENOM:HBG353770"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="UniParc:UPI0000EF9EEF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C6"
FT                   /transl_table=1
FT                   /translation="MLSTVATFSEPVKIFLVLPDNTTSLLTHESIAETLISAIHRRGAD
FT                   NLHSLTAVSNNAGLAGKGGLSTLTQAGQVNRLILSYLGNNKALEKKYLTGNIAIELCPQ
FT                   GSLAERLRAGGAGIPAFYTPTGVHTLLQKGEIPVRVDESGKVLERGKPRETREFNGKTY
FT                   MMETALNGDVAILRAWKVDAAGNCVFRYTTKAFGPIMAKAAALTIVEAENIVPVGSIDP
FT                   NDVDLPGIFVDRIVPATDEKHIEIKKLRSDKGDDANKKAEDAATVLRNRIAKRAARELK
FT                   QGYYVNLGVGIPTLAPSFLPEDVKVWIQSENGILGMGPYPTEEEVDADIINAGKETVTL
FT                   VPGAATFDSSESFGMIRGGHVDVSILGALQVSANGDLANYMIPGKVFKGMGGAMDLISN
FT                   PEKTKIVVATSHTAKDGSPKIVDQCSLPLTGANCVSTIITELCVFQVDRTKGELLLTEL
FT                   APGVEVEEIQDKTGAKFSVAENLEIME"
FT   CDS_pept        join(complement(50042..50388),complement(49702..49963),
FT                   complement(49243..49641),complement(48862..49182),
FT                   complement(48573..48806))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959385"
FT                   /orf_name="An01g00210"
FT                   /product="Similarity to hypothetical protein AAO27753.1 -
FT                   Fusarium sporotrichioides"
FT                   /protein_id="CAK36871.1"
FT                   /db_xref="UniParc:UPI0000EF9EF0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C7"
FT                   /transl_table=1
FT                   /translation="MSRYLRAFVLALAGSTLVASASTSTSNSNSWCQTSWSTDTCQLFT
FT                   ESMEYLDRIYDASAGYVYDPSAATALRHDTRTSVWYAVGLLARDQGDDVAQAMTIIRNV
FT                   IDAQFKDTSDQWYGDYQQFPEEPTVGTSAYPPIIYDTWDPNWREFIGTAFIIALEEFPH
FT                   LIDADMTQLMHASLYNDTVGDSYRVGGVDDDNLYPSYTNPSLMRAIITGWTGRKLGDQN
FT                   MTNSGETYATEIIRLFDRADTLSEFNSATYTGVSLIALTMWAKYAAEDSVMKGKGKEML
FT                   QDTWDTIGELYHAGLKNLAGPWDRAYGFDMQKYFGIMSGHIWSLVGKETSPVIDKVYMM
FT                   SHNSDFSISPLIAILSNFHNSLVPSTAIQALKTFPGEHMVNTSAYSIPYDSFPRQVAAW
FT                   LSEGISIGAETFNESVVGGPAINPSQFNPAVIQWDTGAGIGWITLYATEEALNAEVGPG
FT                   YLNLTYPRGTSASQFQFLVSPFETQKNVAGWQDIVGLNVTVSGNMDPTTLNISYSLSDQ
FT                   VIK"
FT   mat_peptide     join(complement(50042..50325),complement(49702..49963),
FT                   complement(49243..49641),complement(48862..49182),
FT                   complement(48576..48806))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C7 "
FT   sig_peptide     complement(50326..50388)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C7 "
FT   gap             51693..51792
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(52351..52766),complement(<51793..52259))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178084" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806147"
FT                   /orf_name="An01g00220"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43415.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397407"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9EF1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D1"
FT                   /transl_table=1
FT                   /translation="MSAPSDASASASSRGTRVHHRILAELGLTSVWQSPRDVKLLCAQR
FT                   FVRLFAYGGSTLILAAYLSALGISDERIGLFMTLTLVGDVAISFLLTLFADAMGRRAVL
FT                   ALGSALMVGSGILFASVGNYWVLLAAAVFGVISPSGNEIGPFRAVEESTLAHLAPNDIL
FT                   SDIFAWYSLIGNAGTALGMMTGGWAINLLQVIWGWPYIPACRVIFFAYAAIGALKFLLS
FT                   IALSSAVEAEKKKPARQSTNEGERQPLLGDQTGNATPQEQQPQKKKSILSFLGDSEVVS
FT                   LFLRLAILFGLDS"
FT   tRNA            55056..55145
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        join(complement(57035..57167),complement(56875..56969),
FT                   complement(56135..56777),complement(55373..56082))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874688"
FT                   /orf_name="An01g00240"
FT                   /product="Remark: CYP4F5 showed omega-hydroxylation
FT                   activity toward leukotriene B4"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAK43416.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG329806"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="UniParc:UPI0000EF9EF2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D2"
FT                   /transl_table=1
FT                   /translation="MSAKLFHLLGEPVANAREIEVDSSLDYDGLRNLIAAHFAIVDPNG
FT                   IGFQSEDAVFTSVAEIIASETPISIAIDGKPYGPLFMTTNYGRTVYHTNDPELSAIVFS
FT                   ESDFFTKKINESHPLHAIKNKEAGVFLGDTDTPEWRTAHKFLPPAFGPKAVRHYAPVMQ
FT                   QTVEDAFKVFDAFDEQGEAWNVYQYMLKLGSQAVGKLVLGIDFQHFANMNAPPHELILL
FT                   IAESLELNKKITARGDWYAKLPFGDSKRLQQIRGRVWNIVDESIQNASRGGVEDLPLQD
FT                   AALKAHNMIDYAIRATDNKGEKLPKTSLIQALVVATGAGFTTTSSLLSWLIYSLVNYPG
FT                   VQDRLLQELVDNGIDADTQITADLTDRLTFMDKFIKETQRRHNPSYQPARTAKVDMILP
FT                   GGYKLPEDSVVIGALHHLHNNPEVWDNPTRFNPDRWDTEEVKNRHKSSYIPFAAGPRMC
FT                   IGFNFALQEVKVFLPKLVYRYRFTKETDGPIEYDPMFQLIRPNNLYVRAERRVKWPPKT
FT                   ESPLPTASL"
FT   CDS_pept        join(57893..58022,58074..58217,58597..59378)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874689"
FT                   /orf_name="An01g00250"
FT                   /product="Catalytic activity: NADH + Nitrate  "
FT                   /EC_number="1.7.1.1"
FT                   /function="heme binding"
FT                   /function="nitrate reductase (NADH) activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43417.1"
FT                   /db_xref="GO:0009703"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI0000EF9EF3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D3"
FT                   /transl_table=1
FT                   /translation="MAQSVPLESTASMGADSQLTEYTLADIAKHNRKDDIWIAVHGQVF
FT                   DITEYLQDHPGGVDVLLETAGSDATTAFEDVGHSEDSREILQEYLIVVRADPHMAKGFL
FT                   DSKEYQRLPLVQKDLLSPNVYRFVFALPDTKGVIGLPIGQHVAIRANIDGNTVSRSYTP
FT                   VSNNLDLGRLELVVKCYPDGLLSGKYLANLTVGDEVEFRGPKGAMRYGRGLCAKIGMVA
FT                   GGTGITPMYQLIRAICEDERDTTEISLIYANRSEGDILLREELEDFARKYPKNFKLWYM
FT                   LDTAPEGWMYGSGYVNEAVLRERLPDPSAETKIMLCGPPGMVNACKKTLGVIGFQTSGT
FT                   ISKMSDQIFCF"
FT   CDS_pept        join(60604..60655,61102..61610,61680..63410)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874690"
FT                   /orf_name="An01g00260"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43418.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329822"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EF9EF4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D4"
FT                   /transl_table=1
FT                   /translation="MKGQGYMDFDLSRSQESALLYRNPTMSTISSMPHSPTDASSPLQS
FT                   YARTCSSCRQRKVKCDRQRPCINCSRSGVECIYPPGRGRAPKRPRNAVNAQLSHRLTRL
FT                   ESIIRSFEYHQNQESSTHPPAAPVALSSRAGSRASETSRIQSVPRTSNSDSENSIEQHL
FT                   GRLLIDDTRSYYVSNVLWANLGDEIAELRDLLHEPLVEEDSAFLEEPVPERPLPTGSNA
FT                   AILGFRALAHSLHPYHPPLTESVTLFGVFQENVSPMVRIFHMPTLARNYWDAVASLESL
FT                   DKDTEALLFAIYYSAVISMEPEQCLRTIGVSKAHASETYLFAVEQALARADLLNTQSVT
FT                   LLQAAVLFLFALRNEDDSRTVWSLTALIFHIAQAMGLHRDGVVFGLKPMETELRRRLWW
FT                   HICLLDARSSEYHGCEPIVRDSAFDTKLPLNVEDADLTADMSELPTERTGVTGMYFCLI
FT                   RCEVMRTMWKLSCVAPGLGGSRLGTGRPSLKEREALVQNLHDRLEERYLQHCDISQPFG
FT                   LASTFVARLMVARAWLVARYLLDEKEHGDNLSGPVRDQLFMSSIEVLELSSLVLTNKAI
FT                   AHWSWHSKTHIQWHAVAFVLSEICTRPPSADCDRAWQYVNTVYNNWKMKESGRKGTLWR
FT                   PIRRLMAKAQYIREMQELDPAGRGRQRAPPNRDSMQGVLGPEMCWGTNAAYVSTPVDTA
FT                   CNVVGALPSEILAGTLDPFEELFPGAPHVESSAHEPCDNIGPMLPLYDDSHIPEWLVPE
FT                   WIRNPPGNGE"
FT   CDS_pept        join(63949..64311,64387..64791,64862..64979,65038..65292,
FT                   65346..65686)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874691"
FT                   /orf_name="An01g00270"
FT                   /product="Putative frameshift"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43419.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9EF5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D5"
FT                   /transl_table=1
FT                   /translation="MSLDHQERTKSEAVLAHPLLYEATTPDVLVDFNGPDDPYRSINWP
FT                   FWKKAITTILYGMTTCWITFASAIYSAGMQPIAHEFGVSKEVSTLGISFLVFGLGLGPL
FT                   LWAPLSEVYGRKMVTILPYFIAGIFSFGTATAKDIQTLMITRFFSGFFGSSSVAITGGV
FT                   MADIWKPEHRGVAIVVYSVTLVGGPCLGPIIGGAFVSNSSLGWRWTEYLTGILMVVQSV
FT                   LDFLVLDESYAPALLVQKARRLRLEGKNWALHAKHEEWDVSISEMSHKYLIRPFQILNT
FT                   PIGLFMSIYGSFVYAILYVNLESFPIEFEERGWGHVTGGLPFVALLVGIFVAALANVYN
FT                   NRYYFRKLRENNGKPVPEARLPPMMVGGVAFTGGLFLFAWTSSPQINYWPSLVGIAFTG
FT                   FGFTTIFQSSINYLVDTFLRFGASAVAATTLLRSILAGAFPLFVQPMFQGIGVNWGITV
FT                   FGCVAAVLIPVPFLFFAFGKRIRAKSQWSTSNSA"
FT   CDS_pept        join(67007..67052,67160..67485,67563..67991,68052..68159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874692"
FT                   /orf_name="An01g00280"
FT                   /product="Remark: possible phosphatase "
FT                   /function="phosphatase activity"
FT                   /protein_id="CAK43420.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG329837"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000EF9EF6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D6"
FT                   /transl_table=1
FT                   /translation="MSSNGITTRKIVCFSDFDGTIFMQDTGHVLFDNLGCGAKRRQMLD
FT                   EQIKSGERSFREVSEEMWGSLRIPFEDGFDVMQEELDIDPGFQEFHKFCIEKGIDFNVI
FT                   SAGLKPVLQKVLDTFLGEQEASRIQIVANDADIKSDGSEWKPIWRHETELGHDKALSIK
FT                   EGRAQAAEDALEGEIPLIIFIGDGVSDLPAAREADVLFARKGLRLEEYCIENKIPYIGF
FT                   DSFSDVKREVEAIMKEDQEKTKGVGKPARFNPRANMWRRISSKQAVPKFVAATPSREEK
FT                   MFLWPESFSEYRPKNADDIRV"
FT   CDS_pept        join(69017..69642,69702..70065,70123..70533,70815..70824,
FT                   71023..71162)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806148"
FT                   /orf_name="An01g00290"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An17g00430 - Aspergillus niger"
FT                   /protein_id="CAK43421.1"
FT                   /db_xref="UniParc:UPI0000EF9EF7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D7"
FT                   /transl_table=1
FT                   /translation="MDLRVTLVKGIASGIGLASESISAYKASREEKKAQAADSDNAVRE
FT                   ATTEDTGVEHLINEQHEEEWVLDEAQDELAGDEHRAYSEPASGDIEGLAVSFLQNYPAP
FT                   PPYAPSPGSPRLSCPVVLSQRRPKSRKRGFIRAYAPVLEDFGIDKTMFLEFLETSNRAC
FT                   QATPWLQAINLASIGTMFIPEAISIAVSILIQLATDVAMAVDGRRRTNKFFDKINDEFF
FT                   RPRGLFCLVMTWKPGSDSPYATFDMNSTISAAIEHGGAGLMNRVRHKLKSSDAKTHGTL
FT                   PFSECAPLIFPDLDELAEHRGDNQSKLKGAKRRKEFVSDYWDRRSQAKFMMKNPDSALS
FT                   QGHKPTFTSRYADPSHPASSGSLVGLLTGGYMTGERLVQLRSGISGTDGRRGLSRQSIE
FT                   TPPLSLGGLAAGIRAARFGRSPAEDPQGRSVMQGEEGYPQPVTEASTGGQSVPGRGRGI
FT                   RDLRQAGSIGVQTKHSVPYFVTHAIRIAHPEANFTNAHKIATITEGYPSEFTSRPAYS"
FT   tRNA            complement(71366..71455)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        join(71813..71815,71851..71936,72030..72094,72190..72239,
FT                   72480..72503,72727..73004,73067..73574)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874693"
FT                   /orf_name="An01g00310"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An02g10090 - Aspergillus niger"
FT                   /protein_id="CAK43422.1"
FT                   /db_xref="UniParc:UPI0000EF9EF8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D8"
FT                   /transl_table=1
FT                   /translation="MGNCIDMPSYPWISRGTKQRRNRANQETPSEVEGQNRTWHSLGGL
FT                   RGAVPGAGLVAKSTAVFTDLETAVQLSATTKEVESSSEDLSSVPFVPQPRSFLQAHPTI
FT                   SRLPFPNYIPLADRDEARENGWLVTDEENCSQEAAFFFTQWATANRVFHRPYSSLMDFC
FT                   GVHKMTPPSPFMSFATQIGWCPPTGRCWGIRLFLEPQSRNSAPLPHVAAVAYQPMNARD
FT                   GSILGGELVAILSIMHSRVKEPKVESEEVMEGLSDMNEQELEDLSKKSPAFPDEQKFPV
FT                   LLVSFVGPQHARLLCASLNTNLLVIHLSKLYSFEREQDAPLDLFMSWLFARPVAGA"
FT   CDS_pept        join(complement(74092..74876),complement(73906..73954))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959386"
FT                   /orf_name="An01g00320"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An08g08380 - Aspergillus niger"
FT                   /protein_id="CAK43423.1"
FT                   /db_xref="UniParc:UPI0000EF9F18"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7D9"
FT                   /transl_table=1
FT                   /translation="MTAIILPEDQNGWRDQARRNKVENQTLRMNVKLYSASHVSHRQYL
FT                   LFRTLLPPIVQPNQLNVQTFGKPHLMIPANQRLNCLAFNEYIANFTNRQAQATGWVWGG
FT                   TDRLFRVPAVQQQQVIRNLTINGINRGATESTVNTAFLSFLHALSDLCPQPAQRLWTTE
FT                   RKKLVADFGTPQRERKFVAYTDGQLEDATTGRILALVECKRSWRDNHSPKVDMQEVAEI
FT                   VAWIKNFPAVAGAADSRVLLSKDGTELYICVFGYDDGWLSHFKRESNHTSEDYCK"
FT   CDS_pept        join(77956..78099,78152..78666,78715..78798,78847..78923,
FT                   78972..79004,79056..79207,79258..79746,79802..80194)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653513"
FT                   /gene_name="abfA"
FT                   /orf_name="An01g00330"
FT                   /product="Probable alpha-N-arabinofuranosidase A "
FT                   /EC_number="3.2.1.55"
FT                   /function="alpha-N-arabinofuranosidase activity "
FT                   /biological_process="L-arabinose metabolic process "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK43424.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0046373"
FT                   /db_xref="GO:0046556"
FT                   /db_xref="HOGENOM:HBG329864"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EF9F19"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7E0"
FT                   /transl_table=1
FT                   /translation="MVAFSALSGVSAVSLLLSLVQNAHGISLKVSTQGGNSSSPILYGF
FT                   MFEDINHSGDGGIYGQMLQNPGLQGTAPNLTAWAAVGDATIAIDGDSPLTSAIPSTIKL
FT                   NIADDATGAVGLTNEGYWGIPVDGSEFHSSFWIKGDYSGDITVRLVGNYTGTEYGSTTI
FT                   THTSTADNFTQASVKFPTTKAPDGNVLYELTVDGSVAAGSSLNFGYLTLFGETYKSREN
FT                   GLKPQLANVLDDMKGSFLRFPGGNNLEGNSAENRWKWNETIGDLWDRPGREGTWTYYNT
FT                   DGLGLHEYFYWCEDLGLVPVLGVWDGFALESGGNTPLTGDALTPYIDDVLNELEYILGD
FT                   TSTTYGAWRAANGQEEPWNLTMVEIGNEDMLGGGCESYAERFTAFYDAIHAAYPDLILI
FT                   ASTSEADCLPESMPEGSWVDYHDYSTPDGLVGQFNYFDNLNRSVPYFIGEYSRWEIDWP
FT                   NMKGSVAEAVFMIGFERNSDVVKMAAYAPLLQLINSTQWTPDLIGYTQSPGDIFLSTSY
FT                   YVQEMFSRNRGDTIKEVTSDSDFGPLYWVASSAGDSYYMKLANYGSETQDLTVSIPGTS
FT                   TGKLTVLADSDPDAYNSDTQTLVTPSESTVQASNGTFTFSLPAWAVAVLAAN"
FT   sig_peptide     77956..78030
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7E0 "
FT   mat_peptide     join(78031..78099,78152..78666,78715..78798,78847..78923,
FT                   78972..79004,79056..79207,79258..79746,79802..80191)
FT                   /product="Probable alpha-N-arabinofuranosidase A "
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7E0 "
FT   CDS_pept        join(81209..81435,81543..82518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874694"
FT                   /orf_name="An01g00340"
FT                   /product="Similarity to hypothetical protein SPCC320.08 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK43425.1"
FT                   /db_xref="HOGENOM:HBG329870"
FT                   /db_xref="InterPro:IPR009262"
FT                   /db_xref="UniParc:UPI0000EF9F1A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E1"
FT                   /transl_table=1
FT                   /translation="MSADNEKSAAVADVQPQPEYSTEKTEQVHTVTETSEQTSQPHDQE
FT                   AQQEQQPTQGRAARLFAYMKTRDFWLVLILGQIIALADISSSTFSTLLSNAGNSIPAFQ
FT                   TLWIYILLNLVYTSITLYKYGFKKWFQMLYRDCWRYFILAFLDVEGNYFMVLAYRYTSL
FT                   LSAELFSFWTIICVAIISFIFLRVRYHITQYLGIFLACGGLGMLIASDYLRGANYPAED
FT                   QVKGDLFALLACTIYAFSNLFEEFMVSKRPMYEVVGQMGFWGMFINGVQCAIFDRSSFH
FT                   GATWDKKVGGYIAGYTIVLFIFYTLAPIMLRVSSAMFFNISLLTMNFWGLIIGIQVFHY
FT                   SVQFLYPIAFVLIVIGLFVYFIMEGEMGEAKKPWLGKDQERGVDGVGTGRRAQQTGHAI
FT                   V"
FT   tRNA            82910..82981
FT                   /gene_name="tRNA-Ala (AGC)"
FT   CDS_pept        join(84225..84651,85003..85065,85112..85146,85277..85369)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874695"
FT                   /orf_name="An01g00360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43426.1"
FT                   /db_xref="UniParc:UPI0000EF9F1B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E2"
FT                   /transl_table=1
FT                   /translation="MDTIEPSGESRPEKSSSVGDEYRTFVRSNTNADVTMSTARLNEMV
FT                   EAAPGTDDEKLLCSRQFLRKHIFTKECDTNMISYPVHVAAESNNASVGNRTDDAEGQFN
FT                   HRKRCSMLRLKMSISISRWLRLSHPARINRRTPVLRLMRYHLGPLKTGETLQNVSASET
FT                   GWMMSCTVARSEASSGCGYLCRIQQIDRSPAIKLTPHRGAGI"
FT   CDS_pept        join(87292..87564,87621..88529)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806149"
FT                   /orf_name="An01g00370"
FT                   /product="Function: aspartic proteinase "
FT                   /EC_number="3.4.23.18"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK43427.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG323988"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000004F5FD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E3"
FT                   /transl_table=1
FT                   /translation="MRKYRFHPTKPGPYTLSSSIQQTGRPYTEKPIGGRAHIRQLVRKK
FT                   STTSDEVGEVPAEDVQNDSMYLATVGIGTPAQNLKLDFDTGSADLWVWSNKLPSTLLSE
FT                   NKTHAIFDSSKSSTFKTLEGESWQISYGDGSSASGSVGTDDVNIGGVVVKNQAVELAEK
FT                   MSSTFAQGEGDGLLGLAFSNINTVQPKSVKTPVENMILQDDIPKSAELFTAKLDTWRDT
FT                   DDESFYTFGFIDQDLVKTAGEEVYYTPVDNSQGFWLFNSTSATVNGKTINRSGNTAIAD
FT                   TGTTLALVDDDTCEAIYSAIDGAYYDQEVQGWIYPTDTAQDKLPTVSFAVGEKQFVVQK
FT                   EDLAFSEAKTGYVYGGIQSRGDMTMDILGDTFLKSIYAVSALLLALRGDIEAH"
FT   CDS_pept        join(complement(90055..90251),complement(89624..89997),
FT                   complement(89179..89561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110313"
FT                   /orf_name="An01g00380"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43428.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9F1C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E4"
FT                   /transl_table=1
FT                   /translation="MAVPSDSDASSISPLSVDPIAVPNTAETEKQSVDEDSTPLPPPPP
FT                   NGGIFAWVQVAGAFFLFFNSWGIINTFGVYQSYYETSLLRDYSPSSIAWIGTVQSFLLL
FT                   SLGIIVGPIFDRGYIKFLIIAGTFLIVFGLMMTSISKEYYQFFLAHGVAVGLGSGLLFI
FT                   PSVAIPVTYFTSRRAVAIGIAASGGSVGAVIFPIVFHKLIDRVGFGWTTRVIAFVALAS
FT                   LLFSIAVMKSRLPPPTQARQLLDLMAFRDIPFLIYCLALFFDLVGLYFPYFYLPTYFTT
FT                   YLHAGGNISFYVLSILSASSFFGRIRPTCSLIVWDR"
FT   CDS_pept        join(94559..94732,94904..95614)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874696"
FT                   /orf_name="An01g00390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43429.1"
FT                   /db_xref="UniParc:UPI0000EF9F1D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E5"
FT                   /transl_table=1
FT                   /translation="MIQRLMRSLFTITIFVSKLYNIPFGCDCFVSRCIVHTQPIGSKLS
FT                   ASSDASQEQQKEQLAHPPPCPNVYRPSPTSSERILLTSRQAKAKASSSSPDFSILSPFP
FT                   LPLRVRDCASAPPLAHAAERHNRTTLDHTMSYTSSSRFSRSPSPAPRTRRPSPLERTSL
FT                   HLRLSLLSGEKYDQESSAKEPDLRRCLSHAHIHAKSMAMVKRDIRVHIRSMGMAMDDDS
FT                   DEELLDHEVLPPPPSRRSSRSSSKAAAAPRVTVSPKPSEKSSLLDKGRKCLEKLFPRKN
FT                   NVHLAQSRVTVVT"
FT   CDS_pept        join(98078..98662,98715..98945,98995..99156)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110314"
FT                   /orf_name="An01g00400"
FT                   /product="Similarity to hypothetical protein SPBC12C2.09c -
FT                   Schizosaccharomyces pombe"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43430.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG749828"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI0000EF9F1E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E6"
FT                   /transl_table=1
FT                   /translation="MQATFADSPSITETLPRQRKPSLPPGAFAEEPATPEKVLFNDGAP
FT                   ILVSYDEIPEWYQDNEFIRHGYRPVSNSTHACFASWLYLHNETVNIYSHLVPAVFFLAA
FT                   EGMFYQHLQVKYPEATLSDHAIFAFFLLTAVICLGLSTTYHTLMNHSLQVSELWLRLDF
FT                   VGIIVLTLGDFVSGIYMVFYCEPLLRRLYWGMIISLSCITIMILVNPKFQGPRWRTFRV
FT                   CTFVGTGLSGFAPLIHGISVFGFAKMMVQSGMPYYLGEGGLLILGALFYTMRIPESIKP
FT                   GRFDIFGCSHQVFHVLVALTTVVQLIGILSAFDYNYNHGKCRLP"
FT   tRNA            complement(99557..99646)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        join(100703..100995,101097..101732,101786..101903)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110315"
FT                   /orf_name="An01g00420"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01580 - Aspergillus niger"
FT                   /protein_id="CAK43431.1"
FT                   /db_xref="UniParc:UPI0000EF9F1F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E7"
FT                   /transl_table=1
FT                   /translation="MEVAVTHLRTLVGLATRTDPSPLPPVQDIISHIQSLYDSGRPFYT
FT                   KDLLQCIKEQLRGARDGIIQTIRVPGVDEVIVEFPVMTGQVFPTPEQGMELIVRNPCIE
FT                   YLSVQELLQDCDLRDDNLAYNHIQIGHYRFLRNIHTKELYSDLSVASVPDASELLRRSS
FT                   RIWENTAQCQALRAILMSRKDISISRIVGLALGSFATVYPSLQDRSAFQHALLLTLRDI
FT                   SCNMQNIAQQSIPCFAQDPMCNIVDITAAEEAGITILEDTDGFLEIDDSTVVFSCAPDI
FT                   PVRQIVLDLARPAVLIWDKLRNEDDDDHSADPASPRVMTCLRNIYEEFEFPDYDKHFGD
FT                   LAVYIRRN"
FT   CDS_pept        complement(103009..105537)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874697"
FT                   /orf_name="An01g00430"
FT                   /protein_id="CAK43432.1"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniParc:UPI0000EF9F20"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E8"
FT                   /transl_table=1
FT                   /translation="MIRWHDPSCRRPAVSVASGIPCCNYCFAIAIVEQETIVTDSSVPL
FT                   NKSSHSSPWPSCLISGSQTISKRSTQHGESEFRTDSQESLFPTLPSEDHIRLVRLDAGR
FT                   IDGLLHVDLEVVHIYNQPAQLFEILSYTSANESEGSDSSHIVFVGKYWDIVYVSYNCQQ
FT                   ALRFCRNQDFDRLLWVDLLCIDQANLKEKSQQTSLRRELCLKASKVVAYLGEETSDGRE
FT                   ALEFLKSMAITVQEMRTGHEHINEVNRRALRILLERPLFTRLWFLVEVLLARNLELVCG
FT                   AQSAPWPKAPFALAHEDVPIPDWLFKGEKWYGLTDRDLLPILSQTSSYKCSDPRDKVFA
FT                   VLSLISQSELDPDYTVSVEKIYIGLAAYLIAVCSSMDVLEFAGLNVKTFDVPCWVPDWS
FT                   QALSTFSQVLSASDQDLNRKRNKLPGARHVLFHDYLAFKCESHLSVATPILRTCSIRIC
FT                   GLQGSIKRNRGYVHISMALDKRATLFVSFLDRGYEEGPDSLFLLGGCKSPVILREGSAP
FT                   GSYLLVSACALSLGRPPSNWLLPWASSRVTQQISILRLSSEEKSLIREVHLVIEQTRRQ
FT                   SVALDDTIPVPFSSARDKVFSFSLCLFTGLPELDRQLWRTWEKFNTELGWMFRDQQATW
FT                   LLLQLLNNLDAAEIQGQGQIKIDRCYEFLALKYSGVEYPSTYAWDLSRFVWSFLKRLDP
FT                   EQATQKPQCTPTPILKIMMKSLLQIQQWAATTEQLLKIFEYTQTVLGSCWESFPGSHLP
FT                   QKWVGNYENFNKAVGTDLHQNITDLRPSLDLSCHWDIQEFEDNARARDRLWDVELPPEL
FT                   EPTIDNNMAVHAGFRSLGLELYDERIIDIV"
FT   rRNA            108503..108621
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="An01e00440"
FT   CDS_pept        join(complement(110520..110564),complement(109636..110458),
FT                   complement(108997..109124))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874698"
FT                   /orf_name="An01g00450"
FT                   /product="Function: mmsB of P. aeruginosa is involved in
FT                   valine metabolism."
FT                   /EC_number="1.1.1.-"
FT                   /function="coenzyme binding"
FT                   /function="phosphogluconate dehydrogenase (decarboxylating)
FT                   activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="CAK43433.1"
FT                   /db_xref="GO:0004616"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG329926"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9F21"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E9"
FT                   /transl_table=1
FT                   /translation="MAPQLAWLGLGNMGRGMAKNLAAKGSLATPLIIYNRNITRAQEFQ
FT                   AATPNTTIANTVSEAVTKSDIIFTCVGDDAAIQSIIDASIASGSPLTDKLFVDCSTVHP
FT                   DTTTSISEKLQAKGARFVASPVFGAPPMAAAGQVIPVLAGPREAVEQVKPYTTGVIAKA
FT                   VVDFSDQPPAKASQLKILGNTFVLGMVESIAEGLVVADKCGLGTDALHQFFEAVFPGPY
FT                   VAYSARMRSGDYHERKEPLFAVDLARKDARHAMDLAGKVGARMKGIELADDYMAKVKEH
FT                   MGERGDVAEPSNEAFSVNYEINITRQEIAKKRARLSELQAELRNRPSVSA"
FT   CDS_pept        join(111845..111907,111969..112646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874699"
FT                   /orf_name="An01g00460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43434.1"
FT                   /db_xref="UniParc:UPI0000EF9F22"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F0"
FT                   /transl_table=1
FT                   /translation="MPSQEGVVAAFLVINKEQRGESWTYEPRSPVSQGSILGQSLCHAG
FT                   NLPVINSIKMSYRRPPFLVPSKRYSPKTIIFSSFDCLLNQRSNLAQASTSKKMKYISNW
FT                   HPVHRVPIVDGKFQNPTTGIIEEIADKYFVICGPPFIKATWIILKPGSGFLITCTDFPP
FT                   PIEDVFVAIAEHVKAKAYEIENISATKYEMTVVCSSDLTEEMMHEVVMRMKRELWKDVY
FT                   IPPEEIAAFEAFVEEERKKENPRF"
FT   CDS_pept        113663..114175
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653514"
FT                   /orf_name="An01g00470"
FT                   /product="Similarity to hypothetical protein jhp0584 -
FT                   Helicobacter pylori"
FT                   /protein_id="CAK43435.1"
FT                   /db_xref="HOGENOM:HBG467956"
FT                   /db_xref="UniParc:UPI0000EF9F23"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F1"
FT                   /transl_table=1
FT                   /translation="MSTIHWPHRFLPGTTENFVSNEIYVPQLTASRVWPNLITPSRWTS
FT                   YYSNVDEVTPPPTSDATFQNPGDKFSFATFGFPPLQAEICECVAPTANSPGRLAWRAWQ
FT                   EGDEETALEVYHAWIVEDMKWGVVRILTQEVQAGKPAAGLAEKKPNPMLLGHQEWVDGL
FT                   ARFSLEN"
FT   CDS_pept        114545..117211
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806150"
FT                   /orf_name="An01g00480"
FT                   /product="Similarity to hypothetical protein AAO49461.1 -
FT                   Leptosphaeria maculans"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAK43436.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI0000EF9F24"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F2"
FT                   /transl_table=1
FT                   /translation="MAPAVSALSQTLQSLTQSKIRELEKRRKSYEARKLAILEAAQSTQ
FT                   DPRRRLKYLLNGAKVLYPSAATDPTMANIERWIHQSSYDSSIPPQKLHEFETELLRKLN
FT                   IQSRKLDLADLYSRLLTEWVDPPVAARDESEMAVDDDYMVVDERQKQRLQQLCDQFDTS
FT                   VFEPLETDEGRIRAFLDDLFPDEESMEALGNLRRQLRDSTMSLWKVKEPFTSQSVEYCV
FT                   RGLLNEELLSEEKREIMNSFLKTPVALTEIADVLNMRYSDIENWAWHAGENGIPVVPRQ
FT                   QANGKYRIWMDEDLLQLIFLQYIGTRHCNILKLLLLKFVQQDSVWNWKPERQMTTRDRL
FT                   RRKFYMSGDSTYSTAEELRFTEYLETYFLSQLPKTEQTLSEKGNSYDDDNENAGTSSTR
FT                   HEGKNFRQQLLRKIATEALVRRHLHGAAVVIQSDMKWYATCLPHSTIVIIMKYIGFPQN
FT                   WIDFYRRYLEAPLNMDSSYEGREPVGPRIRKRGIPFSHAAEKLLGEMILFFMDLAVNRE
FT                   TGLLLYRLHDDLWLCGEPAKCVRAWEVMGEFAKVTGLEFNYSKTGSAYLAESKSPRIAA
FT                   QLPKGSVTFGFLKLDADTEEWVIDETLVDAHVRQLKHQLDRCDSVISWVRTWNSCIGRF
FT                   FKNTFGQPAYCFGEPHVRAILTTYKKIQDTILDSSISGSTSIPEHLRAMITRRFGETEI
FT                   PDAFFFFPEELGGLGLRNPFTSVLLVEGIMSGPPLARIKQFLDEEKNLYAQRKKEFEDL
FT                   SVQRRRKMLAICASIADLEGDLVTEREVHTFMSFEEFSRFRESQSSGLRRMYIDLMCVP
FT                   TMQPIDETRELRRALQETLTHEQVGKLDSEELWHLQLYAGEVLERLGGIRLVDQKFLPV
FT                   GVLGMVKETRVKWQMVL"
FT   CDS_pept        join(118609..119069,119144..119628,119688..120292,
FT                   120342..120776)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874700"
FT                   /orf_name="An01g00490"
FT                   /product="Similarity to isoamyl alcohol oxidase mreA -
FT                   Aspergillus oryzae"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK43437.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG323919"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0000EF9F25"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F3"
FT                   /transl_table=1
FT                   /translation="MKGYLSRGLAISMVAPAAYAQATRAVASLSAAAATVTTSPSAAPP
FT                   LFPWEKVQLTENALARVDTALNNQSLSRIFAFGAGDSANNSGTPQHSCKVMPGDATWPT
FT                   ESTWNIFDQLLGGGLLKPAPLAASCYPDWPEYNTEQCSEITSNWLDDSLHSIMAPLDEG
FT                   RSCMPVGYNYTSTCTQGGYPTYVVNVSTVAQIQLSVNFARNQNLRLIVKNTGHDFNGKP
FT                   SGKGGLSIWTHRLKDKVFYPSFTADGGYVGPAIKLGAGVQVSEAYDFGKELNLTVIGGG
FT                   CLSVGVAGGFTLGGGHSPLSSMYGMAADQVLALEVVLADGRFITATSKQNSDVFWMLLG
FT                   GGGSTIGVVTSMTVKAYPQLPTTLVTFNWTMNDTPNAEAFWAAFQSYLDNFEDFVNAGT
FT                   YGYYFLGSSGAEKGEASSGETDYNFRMVSFVAPNMTVPETQNLLKPWFDTLNSLNVSFT
FT                   PIYSHADNFYEVWEEDNFPLETGGLDIYKLASRLLPRNVFENQDLRNRNFLAQKDAVDK
FT                   GLFIMGFHISGKGSAVEPPTNIAVLPAWRDALSHVIVATEWDFTSSWETVYNSSLFVTD
FT                   WMDALREISPDSGAYMNEGDLLEPNFQQAFYGANYPRLYELKQKYDPTGLFFALTAVGS
FT                   EDWEVQVTDPLPYSWNNNGRLCPRSS"
FT   sig_peptide     118609..118668
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F3 "
FT   mat_peptide     join(118669..119069,119144..119628,119688..120292,
FT                   120342..120773)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F3 "
FT   CDS_pept        join(complement(122862..123009),complement(122641..122765))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959387"
FT                   /orf_name="An01g00500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43438.1"
FT                   /db_xref="UniParc:UPI0000EF9F26"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F4"
FT                   /transl_table=1
FT                   /translation="MDRSATSRNTGSSGHAANGAHSDLPDLATYQAQWAKIHDDTVRQI
FT                   NEALAIPFKLAINDEYPEKLAISGVYRNSVDSDFLFGICLLFRLG"
FT   CDS_pept        join(complement(126986..128114),complement(126619..126907),
FT                   complement(126484..126562),complement(126203..126418),
FT                   complement(125838..125891))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110316"
FT                   /orf_name="An01g00510"
FT                   /product="Catalytic activity: hydroxylation of n-alkanes at
FT                   the terminal position"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, reduced flavin or flavoprotein as one donor, and
FT                   incorporation of one atom of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43439.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016712"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397671"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002402"
FT                   /db_xref="InterPro:IPR002974"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EF9F3E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F5"
FT                   /transl_table=1
FT                   /translation="MAFDKVDHPVITIATVILVLWYTTTYLQRKWTHRRIIKANNCQPP
FT                   PSYPQKDPIFGLDILFEQIKYSKKHKILERAIERFKLYGNTFTQRRFTPFIITCEPENI
FT                   KTVLSLRFKDYGLAGRIDAMGPLLGHGIFTTDGEHWAQSRAMVRPNFAKEQVAHLDIFE
FT                   ELVNELISLIPTEGRTVDLQELFFELTIDSATEFLFGHSVHSLQKRRTGARDSTEQDFA
FT                   SAFNYAQKAIVADLRLGRLKYLRRDRKVGECIRTCHELVEQFVDSAMRVREQSSEQKAL
FT                   PVGDSHDAKEKQKYLFLHGLAQQTGDRRRIRDELINILLAGRDTTASLLSNLFFMLAKN
FT                   PRIWNKLREEIAFLEGRAPSYEQLRNLTYVRYCLNESLRLHPVVPANLRFANTDTVLPR
FT                   GGGPDGKSPVFVPKGCTVAYNVYALHRREDIFGPDANEFRPERWAEIRPGWEYLPFNGG
FT                   PRICVGQQYALTEAGAVGGGLCTDTLFEEWDEGGIELVRVCYMDGGIEDSVAASVTSEG
FT                   ESGASWSRDSARVPDSDGRQFHVRQDSVAWKCPTCAAAQKSLNLMQPPIAYSSLGLPGD
FT                   VHYATEGSSQDP"
FT   CDS_pept        join(complement(130945..131021),complement(130637..130751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874701"
FT                   /orf_name="An01g00520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43440.1"
FT                   /db_xref="UniParc:UPI0000EF9F3F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F6"
FT                   /transl_table=1
FT                   /translation="MSSSGKDFSYKGSGTNSQVSAIAYRIDGSYYYSNPNGSTYYNNGN
FT                   GGSTYTPPSGNGGSTGKK"
FT   CDS_pept        complement(133164..134012)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178374" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874702"
FT                   /gene_name="proctase-A"
FT                   /orf_name="An01g00530"
FT                   /product="Proteinase aspergillopepsin II-Aspergillus niger "
FT                   /EC_number="3.4.23.19"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK43441.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG325156"
FT                   /db_xref="InterPro:IPR000250"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI000004F5FE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F7"
FT                   /transl_table=1
FT                   /translation="MKFSTILTGSLFATAALAAPLTEKRRARKEARAAGKRHSNPPYIP
FT                   GSDKEILKLNGTSNEDYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSSSSGYGGGYGY
FT                   YKNKRQSEEYCASAWVGIDGDTCETAILQTGVDFCYEDGQTSYDAWYEWYPDYAYDFND
FT                   ITISEGDTIKVTVEATSKSSGSATVENLTTGQSVTHTFSGNVEGDLCETNAEWIVEDFE
FT                   SGDSLVAFADFGSVTFTNAEATSDGSTVGPSDATVMDIEQDGTVLTETSVSGDSVTVTY
FT                   V"
FT   mat_peptide     complement(133167..133958)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F7 "
FT   sig_peptide     complement(133959..134012)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F7 "
FT   CDS_pept        join(135495..135552,135602..135618,135997..136184,
FT                   136473..136508,136662..136740)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874703"
FT                   /orf_name="An01g00540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43442.1"
FT                   /db_xref="UniParc:UPI0000EF9F40"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F8"
FT                   /transl_table=1
FT                   /translation="MTDEARGGIRIGHSTNNDEDKAGDKSHPEVSSVDTYKLSSEMGSS
FT                   SSSSSEMDLPLLGGSPDCDRVLGILGSCGVKPSTRHEPVHMEHHNPGIHLIGDARDIID
FT                   SVTDKGHVMNQPGHSIQARLG"
FT   CDS_pept        complement(138081..138920)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178363" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874704"
FT                   /orf_name="An01g00550"
FT                   /protein_id="CAK43443.1"
FT                   /db_xref="HOGENOM:HBG330001"
FT                   /db_xref="UniParc:UPI0000EF9F41"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F9"
FT                   /transl_table=1
FT                   /translation="MYFSTPLLLLAAALPSALSQPTPTKPQGHSRRQIDISASASISVS
FT                   APSSSSSSSSTSSASSSDWTSTPSDGDYSTSGFGSSTSAYGSGDTYVGNVGNPWGSNMV
FT                   EVSASEASNYKYVMQVTGQNTEDWTVVFWNKYGPDGKMDGWYGYSALSFTLSPGDTKYV
FT                   AFDEDTQGGFGAAQGSSLPTGSSGGYACTWGEFDFGSTANNDWSGFDVSAIQAQDNDMS
FT                   VQGMQICDALGSTCSSMTADAAEVDNAYTSAETDEGGIGGNLSAGPVRLAVVIDYSG"
FT   mat_peptide     complement(138084..138863)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F9 "
FT   sig_peptide     complement(138864..138920)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7F9 "
FT   CDS_pept        join(complement(141971..142179),complement(141666..141888))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874705"
FT                   /orf_name="An01g00560"
FT                   /product="Function: Sec11 from S. cerevisiae is a subunit
FT                   of the microsomal signal peptidase "
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43444.1"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG564658"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI0000EF9F42"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G0"
FT                   /transl_table=1
FT                   /translation="MWKGLSVLTNSPSPIVVVLSGSMEPAFQRGDLLFLRNTQPTLNVG
FT                   EIVVYQVKDKDIPIVHRVVRQFGEGSEAKLLTKGDNNIADDTELYARGQDYLDRDDVVG
FT                   SVFGYIPFVGYVTILLSEHPWLKTAMLGVMGLLVLLQRE"
FT   CDS_pept        complement(142634..143836)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653515"
FT                   /orf_name="An01g00570"
FT                   /product="Similarity to hypothetical protein -Campylobacter
FT                   jejuni"
FT                   /protein_id="CAK43445.1"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="UniParc:UPI0000EF9F43"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G1"
FT                   /transl_table=1
FT                   /translation="MEYPSKQYPVPAGVHIIPEHLLDLRPDSEVDYDLLHPRPVTDEKN
FT                   IWLFWHSGYSTMHPYTKRNVRAWHRRFSKAGWIVRVVDRHPSSPLNIANFIDVNDSNNF
FT                   PQAFAEGTISGTYAKQHTSDLVRLPLLLKYGGIYADVGLIQIGDVDRLWRETVGNPDSR
FT                   FEVLSYNAGDVDERSLTNYFLMSRRDNPLFKRCHRLLLKLWEGNTSTEGMHQSPLLKDL
FT                   PLLTGTGNMTEQQCRELTDYIIQGQVMTLVMGLVDKEDNWDGPKYVAEHVYGIEFMQGS
FT                   QLINDMTAWDGRKAFELMSLSLPKEGEEETAEQKQAREIVEACLKKSFGFKLAHGYILE
FT                   VMNVTLGSLWREHEGSDNVPGTYAHWLRHAIVHWSQDALPPTQPYTALEPIKRGPLLRA
FT                   E"
FT   tRNA            145242..145314
FT                   /gene_name="tRNA-Lys (CTT)"
FT   tRNA            145337..145409
FT                   /gene_name="tRNA-Lys (CTT)"
FT   CDS_pept        join(145907..146423,146563..146636,146849..146994,
FT                   147053..148366,148508..148733)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959388"
FT                   /orf_name="An01g00600"
FT                   /product="Remark: putative reductase "
FT                   /protein_id="CAK43446.1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="UniParc:UPI0000EF9F44"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G2"
FT                   /transl_table=1
FT                   /translation="MPPSIGLIICSQRTPRAGPQIATFIHNTIRESYPPETATITTIDL
FT                   AKWNLPLYNESGMPSFINSADEYEHEHTKAWSREISRHEAFIFVTPQYNWGYPASVKNA
FT                   IDYLFHEWKGKAALVVSYGGHGGGKAAAQLRQVLQGVRMRPLERMVELRFPEIEEVKRA
FT                   AKGEDLGLNVTGYPEVEIEVPRKKILSQVHDTNRIDAGTRHAGTLHSQGNLMSAAYDSL
FT                   FVMRMPGCIISYYPTGLFFKPAYNHRSTHCIPLLYYHSSLMVHFISLFYTLVGLLPAAA
FT                   LPSPTHHSLETITCDICILGGGSSGTYSAIQLKDAGKHVVVIEPNNRLGGHAATLYLPD
FT                   GNYVDYGVEGVFNNELSRNYFLRLGVDWKPLLPLNKRTDFVDFSTGERVNPAAGILQAL
FT                   VSTFLYRSSIKHWTFLTRGVYDLPDPVPEELLRPFREFIEEHSLEAALQLVFLFSQNVG
FT                   NLLDMPTLYAIQNFGVPHVDALIHGYITPKNGMYELYRQAREILGSGVLFQTNVIATNR
FT                   SDSGVEVTVQHANGTRQLIKARNLLITFPPLIKKLQGFDLDETETELFQKWFWRTYYVA
FT                   VVNNTGIPDKLWVTNTDPTNGLGYLPRMPFDFLLQYMGAPGYSTSKLVGDMNFTEEDAR
FT                   DLLAADFARMKAKGTYPIHDPQIVVFGDSSPETLMVSPEDIRNGFYRKLVIYPISARYN
FT                   YSVKLNDTKICLHTGSDFEVALKNLKLWPFFLSRKSRLFVNHSPDTTDNRIYESVLRPL
FT                   IQATI"
FT   CDS_pept        join(149971..150650,150735..150783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234452" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874706"
FT                   /orf_name="An01g00610"
FT                   /product="Similarity to hypothetical protein BAC69773.1 -
FT                   Streptomyces avermitilis"
FT                   /protein_id="CAK43447.1"
FT                   /db_xref="HOGENOM:HBG654853"
FT                   /db_xref="InterPro:IPR019268"
FT                   /db_xref="UniParc:UPI0000EF9F45"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G3"
FT                   /transl_table=1
FT                   /translation="MTIPHYGVWIAQPTRYTAQTEEEDPKSPHIYLYFKDDSSSSKDYE
FT                   AAINVKSTGKDSRLVYWFDRSFSHPITEQLSNLDEGFHLLKSYSHRSRRHQESSSKLKG
FT                   LDFIRTKGLVNIESGAVLSEADTGPHNAVLEALEPILNDAISKKATVYIFGSSYGSGIH
FT                   DVHMNQGSAPSYENGIYEDGALLFSFGDGHWEAVFLAFASQEIPTDDKGEPEEGSKTLA
FT                   SILGQMLLREAVTFGTRFIA"
FT   CDS_pept        join(complement(152456..152485),complement(151615..152385),
FT                   complement(150927..151559))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110317"
FT                   /orf_name="An01g00620"
FT                   /product="Function: converts p-cumic aldehyde + H20 + NAD
FT                   to p-cumate + NADH"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43448.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000EF9F46"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G4"
FT                   /transl_table=1
FT                   /translation="MGSLDKIDFTTFYNTINNELTTTSATRHSLNPATRKPNSPVPVST
FT                   ASDLNRAVDSARAAFKTWSKLSPAERRGKVVALGEAIDLHAEELTALLVQEQGKPHGQA
FT                   AIEVNMSGTWCKQIPQLELNDEVLQDTAEQRVIQRFTPMGVVAGIVPWNFPLLLAVGKI
FT                   APAVYTGNCIIIKPSPFTPYCALKIGELAAKIFPPGVVQVLSDDGNIGPLMTAHPGINK
FT                   ISFTGSTETGKKIMRHCADTLKSVTLELGGNDPAIVCEDVDIDEVMNQLATLSFLVSAQ
FT                   VCMMIKRLYVHEKIYDKFLEAFVNFTKNLKVGNGTEPDVFFGPVQNEMQYGKLKDLFSS
FT                   IQTENLKPALGGSITESEGYFVTPTIIDNPPDNSRVVQEEPFGPILPLMKWSDEDEVIA
FT                   RANDTDTGLGASVWSKDVERAQRIGTQLESGSVWINSHFQVAPNIPFGGMKASGNGREW
FT                   GLEGLKSYTQSQMLWVKKA"
FT   CDS_pept        join(153643..153835,153885..154657,154710..154856)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806151"
FT                   /orf_name="An01g00630"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43449.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9F47"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G5"
FT                   /transl_table=1
FT                   /translation="MAATATALVMREVNSPLSLEDIRLNDLRADEVLVEIHATGICHTD
FT                   LSCMNGNLPASTPCVFGHEGAGVVVKTGSSITHLHVDDKVLLSYAFCGNCEQCTSEHPA
FT                   YCNQWVPSNFGQQRSDGSFTLSFPNGDPLRGNFFGQSSFASLAIVHASCVVKVGPECPL
FT                   DRFAPLGCGFQTGAGAVINTLDVQPGSSLAVFGAGSVGMSAIMAGKIRGAKTIIAVDLN
FT                   QDRLDLAKKLGATHTIIGSDEDIVKQIQAICPPLGVQYAVDCTGVPAVVEKAIQALGTR
FT                   GKLATVGAPTPGKTAKVDIFAQLVFGRQYVGCCEGDGQPEKFLPYLIEQNTKGNYPIEE
FT                   LIKNYPIEKYDEAISDMKTGKTLKAVLLWK"
FT   CDS_pept        join(complement(156282..157010),complement(156073..156220),
FT                   complement(155185..155996))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874707"
FT                   /orf_name="An01g00640"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK43450.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000EF9F48"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G6"
FT                   /transl_table=1
FT                   /translation="MLDVEHRRPPDLEVLSDFDTNQYRFGRIGGHNVVLAILQAGVYGI
FT                   TQAALASSMMRRVFPSIQFALMVGIGGGVPSESHDIRLGDVVVSMPVAGYPGVLQYDFG
FT                   KLGPDGEVTATGALNRPAPKALAAIAAMQADYMMRDSGLMEITSDALRKHPRIRAKFSH
FT                   PGMVNDVLYRADYDHVAGNNCRNCSHHMAVFRTPRETTEPNVHYGLIGSGNQVIKNGKF
FT                   RERLREKHGVLCFETEAAGALEAFRCLVIRGICDYADSHKNDMWQGYAALTAAAYTKDL
FT                   LLLIEGSVSPESTASTSPSEADIPENINLGLPAHGVNQGATHYPSNPLAQSPQVYQQPI
FT                   NSEPPPRYTPSAHSFQHPSIPVMQHPQQPEKTDSEKKHAEQNTSPPRPFVSQSSQPPNH
FT                   SRVRKYYGRMVIEAAKAGNMPVVKKFLEKGGDPNTTTDDWDLTALHYAAMGSHNGLTQL
FT                   LLRAGANPNARAKYTNNTPLFEAASSGHRKVIQYLLRHGADVEVHCQRGKTALHAAAEK
FT                   GHVACVELLVQSKADPDSIDEDGHTPLDLAKKEDHLEIVKYLQRI"
FT   CDS_pept        complement(157927..158202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959389"
FT                   /orf_name="An01g00650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43451.1"
FT                   /db_xref="UniParc:UPI0000EF9F49"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G7"
FT                   /transl_table=1
FT                   /translation="MSGNPERSNGKATLDLVDITLEHIDATARQDTLRKLFRSHVLQIC
FT                   GPEKVKAFNESNDKFKRHMVAYLAQKTVIGLFDSIAQELANELKKI"
FT   gap             159343..159442
FT                   /estimated_length="unknown"
FT   CDS_pept        join(159669..160056,160111..160430,160569..160748,
FT                   160813..160857)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110318"
FT                   /orf_name="An01g00660"
FT                   /product="Similarity to hypothetical protein rfeF -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK32610.1"
FT                   /db_xref="HOGENOM:HBG330065"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniParc:UPI0000EF9F4A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G8"
FT                   /transl_table=1
FT                   /translation="MDPEWGDESEASTVGDEQEDTINEIVAEVIDQFLTEFSRQLGIRQ
FT                   PEDSSPPRSLEPKVPETEEEYREYVWSYIENKLRSYYQPGDQYVEEIVKSAAVRARSLT
FT                   QKYELKAETTPKLAIMALYDFVILCDDSKSMRKDRGTRIRALEETCQRVAEIASAVHEQ
FT                   DVYLRFLNNAEDRHLNKLSPNEIQGQMKKIKYSGLTRLGTVLRTKIVEPLIYDPVINGL
FT                   SAKPVITIVVTDGRPAGAVFLISRVGNDANAETFLSNLKMNEELQEMLYCCQDQLDERR
FT                   EVFRRAGKDGRYSSYLIELFVAALDSQAR"
FT   CDS_pept        join(161149..161157,161391..161474,161717..161777,
FT                   161899..162186,162242..162602,162660..162783,
FT                   162836..163143,163229..163361)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874708"
FT                   /orf_name="An01g00670"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK32611.1"
FT                   /db_xref="UniParc:UPI0000EF9F4B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G9"
FT                   /transl_table=1
FT                   /translation="MSGRLLTSASSFKGSFALFHLRPASSALENKIRLMISVLHTFNNQ
FT                   VFYIEFMCSVQPGDAVRSRVRACLTFNAFVAGSAQITPENPRDIIVGVIPCLLQSSTHT
FT                   ITSNIDWSPADLPPTPREMSITVNSQVVELDCLIPRVVDVEREYEDVEQFIPWVFQHTD
FT                   LMDWDCTQDWPEEEHLFKNLFASLVDYIEEQGHGNMISEILCKETGISNILKPSETITL
FT                   PRKSWRVSKRSSHMNFIYSQSHMFADLMRNIYYRLDDVDEEAPRLGVIPFPRDVRYAVG
FT                   RVQYAARLEGNVHVGTRADFIPIISFTGWYEGQTWNELLTDTICTMLGHLTMNLRISPH
FT                   GGVQSQEVFVVGFHGPYLHICRGFFSRDLIARVHLYGCSDEEEFDLEFTRGYNLYLKED
FT                   WLEAIRALTRLLSLANLKDQAATNRSKSALDSVAHPRLDSLAYSLASFKLFGAIPH"
FT   sig_peptide     join(161149..161157,161391..161459)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G9 "
FT   mat_peptide     join(161460..161474,161717..161777,161899..162186,
FT                   162242..162602,162660..162783,162836..163143,1
FT                   63229..163358)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7G9 "
FT   CDS_pept        join(164378..164425,164478..165590,165653..165985)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000166635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959390"
FT                   /orf_name="An01g00680"
FT                   /product="Catalytic activity: Benzoate + NADPH + O2  "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK32612.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG324782"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000EF9F4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H0"
FT                   /transl_table=1
FT                   /translation="MALNVTTYATIVTVLLLPVLLAIKRLYFHPLSRYDGPRLWALTRL
FT                   PYMLAFRSGRLAHDIKRFHDIYGDTVRVGPDEVSFLDPDCIKDIYSRRPNNPHYKALPK
FT                   DPIRQKPPQPGQPGDILDVEDDDHSRIRKAYAPAFSTQALNAQKPLVTSYVCKMVAQLK
FT                   SRANSTDPSKRIVDLQRWVTYCTFDIICSLSFGEDFGCLDNDNYHEWVGMVVNSVKGKV
FT                   QIAAFRFYPWLFNYLVKSLPKSAQLMVKRHQAMTNEKVQKRLHTAVDRPDFFSYLLKSK
FT                   NELTEPEMEINAATFIFAGSHTLQSSLTGILFHLLKNPEALARVAEEVRSSFPDEEDLD
FT                   ANKLSKLPLLDAAIKEGIRLTAPVPLGITRLVPRGGHTVCGQYFPEGSKVAYNLWAAGV
FT                   SPRNFADPTKFHLERWLNPDEGRFANDRRSAIQPFLQGPRDCIGQNLARLEMSLVIGYL
FT                   VYHFDFVLPNGREALGEWEDQETYAVWMKSPLMVELVAR"
FT   sig_peptide     join(164378..164425,164478..164495)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H0 "
FT   mat_peptide     join(164496..165590,165653..165982)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H0 "
FT   CDS_pept        complement(166755..167882)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217908" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110319"
FT                   /orf_name="An01g00690"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK32613.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9F4D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H1"
FT                   /transl_table=1
FT                   /translation="MPSRRSHTKSHHGCAQCKHRRIKCDEFRPICGSCHKKHIRCSFEG
FT                   QITPQISHHSFAASGTRVDLIPRNDGFQLPLLDLDLLNHWHVATVRTLVHDKSTEKVLR
FT                   EFVPQEALSHPFLMHSLLALSALHLSHHGPVERRHKYTEAAMTHNNISLSLCKPLLNNV
FT                   TSGNCHALFAFSCFVVMFSFAAHGPKADPGALRLSAVLEVFMLIRGVASIVGQARPWIE
FT                   AGGMRDLLKLGEQPREESKTTRARELYTRISDIYDNLRRSSRPDCYDSESLVIEESVQK
FT                   FLDLLQQAISVANPVPSIMMRWPAVVSVKYLDLLQANHPTALVVLAHYGVALELMAENW
FT                   WLDGWGAFLVNIALYRSGPDYGPELVWARKAITRE"
FT   CDS_pept        join(168522..168687,168766..169002,169073..169518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110320"
FT                   /orf_name="An01g00700"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK32614.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG447992"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI0000EF9F4E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H2"
FT                   /transl_table=1
FT                   /translation="MGVAIRSGFEYYYYYPSLAAAVIFIICFLLTTLLHTFQLVRTKTW
FT                   FFIPFLIGGYCYCARAVSANQSPNWTMGPFLINSLLPLVAPALFAASIYMELGRLIIVL
FT                   HAQQHSLIRVKWLTKIFVTGDVLSFLLQAGGAGLMGSHSKSGTETGSHIIVGGLVVQIV
FT                   FFGFFIITTAIFHHRMLQSPTPCSLEINWKKLIWVLYSASVLILVRSIYRLIEYIEGFG
FT                   GYLLSHEVYLYVFDALLMFAVMLIFHVVHPSELNAWLKSGGLVSKGFRFERLNGNSIPI
FT                   S"
FT   CDS_pept        complement(169885..171300)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000121942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874709"
FT                   /orf_name="An01g00710"
FT                   /EC_number="4.1.1.-"
FT                   /function="carboxy-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAK32615.1"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG708517"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniParc:UPI0000EF9F6B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H3"
FT                   /transl_table=1
FT                   /translation="MDEIVRDTLQGLSEIVGDKLLCDQAALVKRPTKEQLVKLLKSSPP
FT                   EQGRSLEDVVQEFEDILSFRYSVNHPRFFAFVPSAASPLSWLGDVISTAFNNYAGSSES
FT                   GSGICAVEESIIRWVAEKFELPPSAGGQFVSGASLACLTALTVARDQLVEDDMRTRATA
FT                   YIAEETHFCVAKALRITGLLKHQIRTVRCNAEFQMDLGSLRQAIIQDIENGLKPYVVIV
FT                   TCGSTNTGSIDPLDAIADIAAEYRMWMHVDAAYGGSVAFCESRKDLLKGIGRADSIAWD
FT                   PHKWLFQTYGCGVVLFKERVRPRESFATTAHFLRDVEDGYIENPFNFGIELTRPARHMR
FT                   LWFSLHILGTNMIDRMILRGFELSDLVETEVSKLSDWEIVTPSSMAVINFRFNPPGMSA
FT                   EAIDDINSLVSKRLATQNIAVVFTTRIRGVVCLRMCTINPQTTDNDIRDVINALDKSAR
FT                   LVSREITEWNKEC"
FT   CDS_pept        join(173504..173725,173778..173861,173915..173990,
FT                   174042..174106,174176..174280,174330..174423,
FT                   174470..174795,174844..174901,174949..175042,
FT                   175096..175283,175337..175396,175446..175807)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959391"
FT                   /orf_name="An01g00720"
FT                   /product="Function: sit1 of S. cerevisiae is a ferrioxamine
FT                   B permease involved in siderophore "
FT                   /protein_id="CAK32616.1"
FT                   /db_xref="HOGENOM:HBG325340"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EF9F6C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H4"
FT                   /transl_table=1
FT                   /translation="MPNNKESSHATEAHISAHDAQGPGVTSDTGSPGVKRIEALSSHLH
FT                   ILDRVFLFCGVFLIAYVYGLDGLLRGTYQPYATASYGLHSVLSSVDILRAVIAAAAQPT
FT                   AAKIADVFGRVELILVSIFFYTLGTIVEASSSTVEQFAAGAVLYQIGYTAIILLVEVLV
FT                   ADVTSLRSRLLFSYIPTLPFLINTWISGNITGAVLGVTTWRWGIGMFAIIYPICTLPLL
FT                   MVLYIVYHRAKKDGTVDHIASSFRTLGVRRLAIELFWQLDVIGIILMIAFLAMILVPLT
FT                   IAGGLDSQWKKAKIIVPLVLGLCCIPAWVVWERACKHPMVPFKLLKDRAVWGALGIAVM
FT                   LNTAWALQSEYLYTVLIVSFGESITSATRIRSLYSFASVLTGSILGIVVFKVRRLKPFI
FT                   VGGTLLFMVAYGILIYYRGGPTSSSHSGIIGGQILLGIAGGLFPYPAQASIQAATKHEH
FT                   LAVVTGLFLACYNIGTAVGGSISGAVWTQILPGELNSRLGNATLATQAYKDPFTFSATY
FT                   PIGTPDRDAVVAAYKHTQRLLCITGICLTVPLVAFSLCTRNLVLTKEQSFANAEEDSAE
FT                   A"
FT   CDS_pept        join(176385..176699,176770..177487,177565..177739,
FT                   177828..178146,178206..178524,178654..179353,
FT                   179406..179619,179689..179952,180022..180219,
FT                   180278..>180823)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653516"
FT                   /orf_name="An01g00730"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK32617.1"
FT                   /db_xref="UniParc:UPI0000EF9F6D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H5"
FT                   /transl_table=1
FT                   /translation="MSANSDAIWEDLLADLKTLPAISFDGFARRIHFRARWHGDFDSLR
FT                   KYIGTDQPYPANDESHDQVLDGMYTGEEFRRLGNWFLAAEFISIDDDGLWQVAEAAQLA
FT                   AFLFYPIFTPEVLRGLMSMCLAEHLNTKFKSNGHPSLMELANTTGFADYFINRIQTKSL
FT                   IINLALTEPTRSDHLFSISVLLVADYLKYKTAWLDIWRLLSKDRPSFKALHAWSLVTWD
FT                   EQAQRDEVKIDNIVKNCGIAATMAYCSVLGSLSTFDALVIFYKAVIAAIDTDSFPELRP
FT                   YLDSIQASMKRLIDEAAIINEFVSYSEKLYTTFYHNMSEKWRDGVRNAWRERNTGALTD
FT                   WINKATSSTYIEPNQPWPVVSQSSLLCGTNLNLSQGKSKQIKGVTNNNRFLVSAKPPRY
FT                   SHEGLTDVMTDGEKPFTTPSQVFYTTTGLRAVDPDSAKTSCPLAQIGPLRRGHVIYRLT
FT                   GNPDDYMYDAVEIRSIEVGHESEQTVYSVSLWAGEQSHHANGYLLAINNPNRAVESTAR
FT                   ALRALPPKKRLSLLASFHELSSTFTKNDIQAIHERLNFELFGSYGKREEDPITRSEIFP
FT                   ALVSPSDQLKAMKYNPRQLPNGVPLDRVERRFSLHAKGDVQENVFEHGVLSIYYHGLSG
FT                   KGVVLITATDAPQNCSKQDIQAFEAMPTSVAGNVKLLHSRRQTGERDSDDEGEYIPLIT
FT                   VSMQYDKSTWAPGEPLDKPKDPMSGMDVQWGFLYPPDGSQTTATRIPILDDLRDQLNEK
FT                   YNRKFDRLYDSWEIVLDDGRIRATVEFNLASVVPFISDAGMDVNTLNVNFKSQLGIDIT
FT                   LPVLFQSFYIDYDVDLRTVKGAIFDYNPLMRDTKGDRRFICGISDIDDSEIYDMRLRAS
FT                   KAYADCADLTAPTAFTSALQPAEVTDQLHLLQEPTVDELLAPPGYDEVAIHNMSQVLIK
FT                   SMMFYHMDDDQREDLTGQSKPKDLPLSLGANLPTDLQKFFREKYAPAFLCQSVMRYEKY
FT                   EDNFTDQEKKNMRYWWDGNGDKCLAKSKEYAEINRRASVEAVSQFNADVLDKYFDDNPK
FT                   EWACTLYAALKDKGRMLTYLAHPIQGNVNVINRECCILDALAPSEGLADQWFEYFVGFA
FT                   SERHLHYPYIDPDEDLAGQWLHDSMRDLIQRVLEGDPSVDEDVRKGLEKDIEEFEKANG
FT                   LDQTATAEARASNIVEKGAIFFGEAKKWLTAVGKGLAVALQGTRLFQLAEASFEQVTKA
FT                   IGDSLPGIKKLKPLATIGMVCRGLLLCDCTG"
FT   gap             180826..180925
FT                   /estimated_length="unknown"
FT   CDS_pept        <180928..181542
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806152"
FT                   /orf_name="An01g00740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43452.1"
FT                   /db_xref="UniParc:UPI0000EF9F6E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H6"
FT                   /transl_table=1
FT                   /translation="NTIALLSQTLTVILDIVEVGSSIGLYTVTGVFATVLPVLGAVLAV
FT                   LGVVMMLINLFVNLFGGSPPPDPVQEFIDHVAKGLVGGFENAPPPKLDYTIPSVIYESG
FT                   EVTGITIKGENTTNDEISIPNARIVVNSGSDDVCLFSTDDFELVEDTDTDKDSDKHLYV
FT                   TPNSTAEGTLSSSVLGDETEYHEFDLVVGGKKRIRRTVCTN"
FT   CDS_pept        join(184131..184357,184426..184444)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874710"
FT                   /orf_name="An01g00750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43453.1"
FT                   /db_xref="UniParc:UPI0000EF9F6F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H7"
FT                   /transl_table=1
FT                   /translation="MTIPYPLIGPESYGLGSKQARRNRSTCSTPRSVDSIVVDAAFAKE
FT                   IQSTNASQEHLDSCASSNKSEKKWKARFSRKFFHFP"
FT   CDS_pept        complement(186071..186286)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959392"
FT                   /orf_name="An01g00760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43454.1"
FT                   /db_xref="UniParc:UPI0000EF9F70"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H8"
FT                   /transl_table=1
FT                   /translation="MSDRTGSTNNNNNNNKKSGGSGGAQITEAQASFITTPRNINQLNT
FT                   WGQSARNRRQGNKEESDSKGPSDSSR"
FT   CDS_pept        complement(187506..189152)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000268799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874711"
FT                   /orf_name="An01g00770"
FT                   /product="Function: pMSS116 promotes ATP-dependent splicing
FT                   of group II introns in yeast"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK43455.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EF9F71"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7H9"
FT                   /transl_table=1
FT                   /translation="MQVSGTTVGTVPYESMAGKLDSKLLQALNVLGFTHMTPVQQRVLT
FT                   ELPDWRSDCLVQAKTGTGKTLAFLLPTLHCLLNGSMAPPRGQVAVLIVTPTRELAQQIA
FT                   KSCDQLTSQMAVPLKCDIAVGGTARASAFSRFMREAPSVLVATPGRLKDYLSEPEAAIK
FT                   LSNIKTLILDEADTMLESGFLADVKHIIRHIPPKSAGWQGMCFSATLPPKVRDVVSVVL
FT                   KPGYSSISTIDENETPTHERVPQYHVLMPSVADSFTTLASVLQLETKNSSKIIVFGVTA
FT                   NMVSLFAAAFSRGLTKLSVFEIHSRLSQSARTKTTAQFKEAAAGILFASDVIGRGMDFP
FT                   NVDLVIQVGLPTNGEQYVHRVGRTARAGNDGRAIILLTEAETFFLRNNRHLPIQPHPQT
FT                   DAIIEAAASYADTVAEAMYTIDEEKKQRAYSSFIGFFAGSGLLKQLRLDKTGLVQMAND
FT                   MAIQGMACPEPPVIDKKIVGKMGLKGIPGFNYGNGGSSVRGASSAPRGRPGGKRDASAG
FT                   GPGEGRGGFEKRQKSTRGRGRGRRGGDQRAA"
FT   CDS_pept        join(complement(190546..190823),complement(190078..190477))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000179135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110321"
FT                   /gene_name="xlnB"
FT                   /gene_synonym="xynB"
FT                   /gene_synonym="xynG1"
FT                   /orf_name="An01g00780"
FT                   /product="Probable endo-1,4-beta-xylanase B "
FT                   /EC_number="3.2.1.8"
FT                   /function="endo-1,4-beta-xylanase activity"
FT                   /biological_process="xylan catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK43456.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0031176"
FT                   /db_xref="GO:0045493"
FT                   /db_xref="HOGENOM:HBG329722"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="UniParc:UPI00000421AC"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7I0"
FT                   /transl_table=1
FT                   /translation="MLTKNLLLCFAAAKAALAVPHDSVAQRSDALHMLSERSTPSSTGE
FT                   NNGFYYSFWTDGGGDVTYTNGDAGAYTVEWSNVGNFVGGKGWNPGSAQDITYSGTFTPS
FT                   GNGYLSVYGWTTDPLIEYYIVESYGDYNPGSGGTYKGTVTSDGSVYDIYTATRTNAASI
FT                   QGTATFTQYWSVRQNKRVGGTVTTSNHFNAWAKLGMNLGTHNYQIVATEGYQSSGSSSI
FT                   TVQ"
FT   mat_peptide     join(complement(190546..190769),complement(190081..190477))
FT                   /product="Probable endo-1,4-beta-xylanase B "
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7I0 "
FT   sig_peptide     complement(190770..190823)
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7I0 "
FT   CDS_pept        join(complement(191549..191690),complement(191427..191494))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875696"
FT                   /orf_name="An01g00790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43457.1"
FT                   /db_xref="UniParc:UPI0000EF9F72"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I1"
FT                   /transl_table=1
FT                   /translation="MMHLMFAIAQLPTDLAALNDRYFHHTTLRKPSDNTTDEKRGIVST
FT                   RQRQLPEQSDLFKPQANIRIVFGA"
FT   mat_peptide     join(complement(191549..191642),complement(191430..191494))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I1 "
FT   sig_peptide     complement(191643..191690)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I1 "
FT   CDS_pept        join(complement(192004..192844),complement(191853..191935))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875697"
FT                   /orf_name="An01g00800"
FT                   /product="Similarity to hypothetical protein AAO51454.1 -
FT                   Dictyostelium discoideum"
FT                   /protein_id="CAK43458.1"
FT                   /db_xref="UniParc:UPI0000EF9F73"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I2"
FT                   /transl_table=1
FT                   /translation="MSSDQTASYLPTPNNVQPTKGPRYKRKYLVSILLGTISLVAIIVA
FT                   VVCLSVLLPKRLKHDNNHDGGNHNTGVSTTQGNDTHSLDPDGSTYNGGGVQNGTGTHTT
FT                   GATPTGDVPHQPSATSNGEDSQRPNGVVNVTDTQPVQGGSQSQDGECHVVSKVSYTFYG
FT                   YPDNDPPGSDISEDCGRGMAAGGIGTHENPLTFATAPGEFDRCEVVYSPYLQKYLINED
FT                   YCEQCTKDWKSHIWHVDVWLGGNSTTYGTEQLKCENSLTSAEESQVVIKNPSSNLPVDL
FT                   TSFYLGGNSVCSLDHIYPEYDTNDYC"
FT   CDS_pept        join(complement(193845..194194),complement(193759..193792))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959656"
FT                   /orf_name="An01g00810"
FT                   /product="Similarity to androgen receptor A hARa -Homo
FT                   sapiens"
FT                   /function="receptor activity"
FT                   /protein_id="CAK43459.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="UniParc:UPI0000EF9F74"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I3"
FT                   /transl_table=1
FT                   /translation="MADDPDVSQWQFSTTWLYFPCTEEYQNRAEQFQRAIENIDSLTYA
FT                   IYHYNPAIPPTMRGVLLAVYHPLDYGTASILAIARGDLVSYRNAAAGQPGGMGPSQSTI
FT                   YLSLNEDDDMDTSEDAMMSTDIQ"
FT   CDS_pept        join(195689..195765,195827..196269,196332..196969,
FT                   197025..197459)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875698"
FT                   /orf_name="An01g00820"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43460.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9F75"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I4"
FT                   /transl_table=1
FT                   /translation="MALWKFPKLNSTLGTLRAYHLAAIIFVSSFLAGYDSGIAGGILSY
FT                   KTFEDDFRYTSAHESKVSSLTVGLEQLGSFVASLFAYYLTDKFGRKWVIIGSTAVFCIG
FT                   VIIQVINTHSLGAWYAGRIIAGIGMGGQSVVVPMYSAEMTPKEIRGRCGSFYQWLYTWG
FT                   ILAAYWIDYVPSASISKTSREWQIPVGLQLVSGGIMVIGACTLPESVRWLLSQNRADEA
FT                   WKSLTWIRGDEGEKTIEEFKETQLGLKAEKAAKENFSLRELWEPANRLRFCVGPMLFVF
FT                   QNATGSSALAVFAPEYFKLLVGSGGNRDLLLTGLFGAVKFIACTFFILFLAERFGRRIL
FT                   LTGGSVFMAICMLITALIVKCIPTESNTSVTSAGRATVAMLYLDIMVYNCSWGPVPWAY
FT                   VPEIFPTRIRALGLACSMLAHWATSFCFSFASPYMIDNIGANTFLLFMAFDIAAALFCF
FT                   VFVRETRGQNLEVAAGTEWDVVEKSADDLAASEKGEVDIDKPSEIGVAPAAGKQLEVVA
FT                   VHDTYGSNFKRRS"
FT   sig_peptide     join(195689..195765,195827..195848)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I4 "
FT   mat_peptide     join(195849..196269,196332..196969,197025..197456)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I4 "
FT   CDS_pept        join(complement(197901..198002),complement(197782..197850))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959657"
FT                   /orf_name="An01g00830"
FT                   /product="Putative uncharacterized protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAK43461.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR003340"
FT                   /db_xref="UniParc:UPI0000EF9F76"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I5"
FT                   /transl_table=1
FT                   /translation="MTVVNSKATVMEWKAKLTAKIELDSQSLESGMDHGQWLQYAKQSG
FT                   SDDGQFLTFLL"
FT   CDS_pept        join(complement(199832..199925),complement(199605..199739),
FT                   complement(199437..199526),complement(199120..199346),
FT                   complement(198877..198957))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806398"
FT                   /orf_name="An01g00840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43462.1"
FT                   /db_xref="UniParc:UPI0000EF9F77"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I6"
FT                   /transl_table=1
FT                   /translation="MPRELHRGRITQGNGRTVKSSLAKRQQHEGGRPTAKKPFRAIVGI
FT                   RCWLTRSVHPLARVSAMVLTPNFPAKEPVEDDPGYYPGNSIREPLASLVVASFDQRDAF
FT                   GSGSYCNPKCPVALPYGGLVGDLGKSGNNQRHGEQKRNRPDPRGGVTPHVPELSVVVNV
FT                   SHCGFGVMNTIPAPDLAIEKELTVQMTLDRGHILVRRCLGPQTPL"
FT   CDS_pept        join(199947..200369,200419..200533,200628..201020,
FT                   201084..201437,201508..201911)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875699"
FT                   /orf_name="An01g00850"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43463.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9F78"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I7"
FT                   /transl_table=1
FT                   /translation="MVVSQSVVGRTNAEKPHGLMGMLKNPYVFMTCAFASLGCIMYGYD
FT                   QGVMSPVLVMENFENHFPYFMGSTVQGWLVASLELGAWAGALFNGYLADRISRKYSMMV
FT                   AVVIFTLGSSLQAGAQKPSYFFAGRIVGGIGIGMFSQVIPLYQAEIAPPELRGSLVSLQ
FT                   QLSITIGTSIAFWLDYGIANPYLADGTYNAAQNHGHTCLGQKTIAWRLPLALQILFAWI
FT                   LFFGMFFFPFSPRWLMSKHREEEATAALSKLRRLPPNDPLLRAEILEIKAAVLFDEESE
FT                   AEAIRQGGKLAPWKMLFAPNMFKRLVLGCGAMIFQQFTGINAVLYYAPQIFSSFGFSST
FT                   KQTLLATGVTGILQIIFTLPAVLLLDKFGRKTFLITGAVGMFCCHIVVAIVEGLYEDNW
FT                   NLNMGLDKPQGWVAIAFIWLFAVNFAYSWGPVTWVLAQEIFPNSTRSRGVSIVASTNWM
FT                   FNFVIGLTTKDMLKSMKYGTYIFFAIFSALGGLFIWKFAPETKDKTLEELDIFFGGGMD
FT                   SIAEADRQRMERIYDSLGLSGVKEVGDLVVEKEKGEITGEVVEMS"
FT   CDS_pept        join(complement(204119..204197),complement(202342..204060))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875700"
FT                   /orf_name="An01g00860"
FT                   /product="Putative frameshift"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43464.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0000EF9F79"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I8"
FT                   /transl_table=1
FT                   /translation="MVYWQSWFLLLGTVASFNPLESLLPDGLSPYGLLPTYHLDPFLKS
FT                   GSNNNQYQHSNLEHPPWKDISPSGGPPDTGVTRHYNFTITRDITAPDGYQKSGILINGQ
FT                   FPGPLIEANWGDMISVTVNNMITTETAEGLTLHWHGLTQAKSPWEDGVPGITQCPIAPG
FT                   GSFTYTFQADQYGTSWYHSHYSAQYTDGAYGPMIIHGPVQPEASYDYDLGPVIISDYSH
FT                   LSYFEVLENIFSIPPVFPNVDNNLINGRGAYNCNSSSTTTCSPASSLARFNFHSGKTHR
FT                   LRLMNTGSNANQKFTIDGHNMTVIANDFVPVQPYTTDVVTLGVGQRTDIIVTXTGNPTE
FT                   SYWMRASIDMTCLNATASIPTVKAAIYYEDADTQPGQPPRPPQPGRATTVPTIPSTSPS
FT                   PTTFKHPPPPPPPPRPWKSPXAKTLPXTPYSTSTTXTFRSDYNTPLLLLGKAGNFSDPD
FT                   PDLNVYNFGSNSSVRLIIYNLFSMQHPLHLHGHNYWVLAQGRGTWDGVVTNPKNPQRRD
FT                   THIIQPGTEDSPAYVVLEWQANNPGVWPLHCHMSWHVSVGLLLNVVVSCFPSFLPSFLS
FT                   FVLSVGVDANVDLISCGTGTAR"
FT   mat_peptide     join(complement(204119..204131),complement(202346..204060))
FT   sig_peptide     complement(204132..204197)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I8 "
FT   CDS_pept        complement(205013..206032)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000003697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653757"
FT                   /orf_name="An01g00870"
FT                   /function="prenyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43465.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG330170"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniParc:UPI0000EF9F7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7I9"
FT                   /transl_table=1
FT                   /translation="METLTQRQTVHKVAITAHHEGVKAQTQPPVTNEMPIQGVAKLVPS
FT                   SWVPYVQLMRLDRPGFLGFFMPTLMGLSAGATLADPPIAPLDFFKSFLFFWFVTNFIRG
FT                   AACTWNDNLDQEFDRQVPRTRCRPIARGAVSTTQGHIFTLAQVAITAWILSHLPAQCHA
FT                   YSLAMGVLHAIYPLCKRFMDFTPVFLGLPFSVTMILPAVGMGVDPFSAPAACLFMVEFI
FT                   WTIIYETIYAHQDVQHDVQAGVKSMAVRYRHSTKIIASVLGVVMVGLMVAVGVLAGLSG
FT                   IYFLVGCGGTALSLVVMIYSVDLTKPASCLYWFRMGFYIVGGSKSAGFLAQYLVDLLG"
FT   CDS_pept        join(complement(208411..208551),complement(208226..208352),
FT                   complement(208048..208171),complement(207541..207980),
FT                   complement(207172..207485))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653758"
FT                   /orf_name="An01g00880"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="CAK43466.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG328236"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="UniParc:UPI0000EF9D48"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J0"
FT                   /transl_table=1
FT                   /translation="MEALVEEVRRQAKSGDEKTRKDILDSLSKLYASIETPDDTVQRFT
FT                   FYNMQLACIRTAIDLKLFELLNQADGPLTVDQLSKRTGANPVFMGRLLRYLASYHAVQE
FT                   VAQDTFTASNISKTFSQRGFQAAVGHLFNNAGPSIQDLPAFLKENGYPDIQDNVKTPFQ
FT                   KVMNTELPAFLWLQQHPENLAFFNEHMKTNRFGMPTFLDVFPALEKAGGLSAERALFVD
FT                   IGGGFGQQAISFREKYSQLEGRVIVQDLAPTTANATQHPGVEFMAYDFFTPQPVKGAKF
FT                   YYLRNIFHDWPDHKCLEILQNIKDAMAPDSYILIDDMVLPNVGVHWQQAQLDMLMMAAL
FT                   GARERTQEQWNKLLQSAGLKINKVHTYTESLKDSIIEAVAA"
FT   CDS_pept        join(209578..209742,209813..210188,210254..210383,
FT                   210446..210513,210584..210918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875701"
FT                   /orf_name="An01g00890"
FT                   /product="Similarity to integral membrane protein PTH11 -
FT                   Magnaporthe grisea"
FT                   /protein_id="CAK43467.1"
FT                   /db_xref="UniParc:UPI0000EF9D49"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J1"
FT                   /transl_table=1
FT                   /translation="MSAPPAGGDQNRGPALVAIYWAEASFAILAVALRLYGRKLINGFG
FT                   ADDYMMVFTLILFITLAAFVTYLADQGGCRHLYYLTTDQQLLVVKFNWITQVWGIFGFA
FT                   TGKSSVALQIMRILGPNDNWMKWLLWFLMVSTTIFCGLDCLFGFVQCDPPRALWEPWIP
FT                   HTCWNTNVQANFAIFISALPTAWNVLVDLVLAALPIPIIWRTSLTLKQRIATCTLLGLG
FT                   PLAAAFGLVKIQYLAGLKERSDLTWQTYNLYVWSGSELFVIIICGCVPPMRPIFTNLFG
FT                   RKSQFTGYYESSSGYKRRHNYKLSTLGSSQPVQSQDEDTEALHSRVEGTGSHLPQSRFS
FT                   ENAIYREVNISIENGPK"
FT   CDS_pept        join(complement(215239..215482),complement(214486..215176),
FT                   complement(213731..214432),complement(213662..213682),
FT                   complement(213407..213603),complement(213021..213286),
FT                   complement(212757..212916),complement(211858..212390))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806399"
FT                   /orf_name="An01g00900"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAK43468.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI0000EF9D4A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J2"
FT                   /transl_table=1
FT                   /translation="MAIASRAAECAQLFDKYARTLDGDELLKQDMENEIFRFNLWAANN
FT                   FILTPGRASMDWRLRNAPLLQSTMAELLDDLKADLINQSNFPFNSTIPTGMLYELPLHA
FT                   VSETLDGLFRLSRAIRRSGILRRYVKVGNYVEFDENGVNLTEAFRNGVKTLIEFRMKES
FT                   KSSNGLRERIINTVCLRQQYFSYLKAKKATNAPISGADQSHQSTPRSALRATASVTGSL
FT                   TSKAQGAARQQSSPMRRPGPSIMTATTAQPDRIPKAYSVKSAHEQQTYDVDCNDADIPP
FT                   PPNVSGNRKESECPYCFLACSKEELSGRRWKHHIIQDLMPYICVLEPCPTPNSLFESGK
FT                   DWLSHMKNQHPVSGWTCVDSTHDTTFFFQSESGFREHLHQYHEDQFDDDDIDDIATACY
FT                   QKLPDDIIIRECPFCPTVQKLELKPKDMINHVANHLISLAQISLAGHIDDGRSQSAWSG
FT                   SSRDSSSLPASIGSLPERLHSEFRDDDETEYLASISGEVIPDADEELIYALWQKVQKPQ
FT                   DDPSLDLTLRHFIAQSGMQAKVTTEGAVVGSNDLDTGQSSEKEQATAPELDRSSEDSAG
FT                   VLQDTAREGSLKIVEMFDEEGNPRLFDEITDDVPPFLCQSDSEIYDKFEELEWEERVRL
FT                   NEGMLTNDPAHPYALEQDPEVSARNRYDNVQAWANSRIHLRVPEGECDFINASPIILRD
FT                   SVTQEERTYIATQAPIIGYLSHFWHMVFHESKDVAVIVMLTQTFEAGREKCAQYFPLHL
FT                   DQASMFLESTFDVKSRSEIRKLELTIGSETKIVWHFLFAGWPEYSKPEGDDCEALLELI
FT                   RLSASKSGPQNPRVVHCSSGVGRTGTFIALEHLLQELESGQLLQLADPEADPVFDTVNQ
FT                   MREQRMMMVYNVKQFQFIYDVLREQTDIKLGKVRPRNNGSLGSQMEEPRPAKLAKIGDQ
FT                   ANKVPAS"
FT   CDS_pept        join(215818..216653,216705..218738,218821..218884,
FT                   219155..219220)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653759"
FT                   /orf_name="An01g00910"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK43469.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniParc:UPI0000EF9D4B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J3"
FT                   /transl_table=1
FT                   /translation="MAHRSADIDLVCLVSDVITALGGTFRHSPRLYRDLKVSLAIMALE
FT                   IHNVDISVALSEEPNLRRTFENMAEALDRAFRKDFVNTKYQQLKAGEETQPPRLSKWWP
FT                   RLFTSWTDSPKVYMKNWTQTSYPYLGLVSELLQSSLQRELRIGELIIDDYRVIRDLTNL
FT                   ANKLVEQLDRGQSFDDDEDFTEKAQPNPSISEAAIRGETSIHYLSQNLYHTLHENWPCQ
FT                   LEGHEHGRKLGHCVEAKFCLDPQWSSRDPDPSRDSFFILLAGSDIIQECRVRWLPTDVM
FT                   IETNTLACLVDHEASKDVCLQLAKDDNNRLWGLELGQPLEVLQLAEECTGRSLESLRKL
FT                   LEIVKPTYAAKRVLGLTLARSLLHLLEGPWVSSYLSIDDIFIFCKVQNGYPYPLFDKVF
FT                   LSTAFKTIDSECGPQASRRPPYSIHPFPTILALGIALAEMELGDELHDIYGQPSFAGLR
FT                   NKPSRLAKKLWEECERRFHLGTGLMRTVRFCTDQTSFLRFADMGKETVFTDSEFVDVYC
FT                   KNAIRPLEEDLVNGAKWTWDEVNRLQRRDLVDQGVCKIIKLKIDPPSNEISERMRNTEP
FT                   KWSKPPGHVSSLVTIPEANGSVEYSQQNLSSDETLRINDKASHCQPSDTQEPVRPKTRD
FT                   GFDVAIICALPIEADAVLSAFDHHWDKELYGKATNDPNFYSVGVMRGRNVVLVHPPRSG
FT                   KAPAANVATACAMSFTKVTLALIVGVCGGVPFKHNKEEILLGDVVISKGVIQYDHGRQY
FT                   SDGFKRKIEMEAALGRPNPQIGSVLAALETQFHRENAQHKITAFLDNLDDDVTSYPGHV
FT                   EDRLFPSWYRHKHHNHQVCRVCADCWNNDDSVCDIAPELNCQATGCEDIRIVKRHRQNQ
FT                   RNQPFVHVGLIASGDSVLKSATHRDQIAENENVIAFEMEGAGAWDALPCVVIKGVCDYA
FT                   DSHKNKLWQKYAAITAAACAREFIQHCSLGITKMALITKYKRPIETRELDLYFRCVPRL
FT                   TEIKPSNNKT"
FT   CDS_pept        219994..220749
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875702"
FT                   /orf_name="An01g00920"
FT                   /product="Similarity to hypothetical lysogenic protein
FT                   CAD54907.1 - Bacteriophage P2-EC58 "
FT                   /protein_id="CAK43470.1"
FT                   /db_xref="UniParc:UPI0000EF9D4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J4"
FT                   /transl_table=1
FT                   /translation="MSAGITAIVTLHSDRLKRHSESEKLVAEYRDPLLLASMELQSRLY
FT                   NILEQDFLCYYENKARRDLVDVYTAFLIGQFFSWTYILRRQVQFLRFSSNKSNQKLSRA
FT                   IEAIQKSFSTDMYGKDDSDFMLWRGEQLAIGEIMTVSDDGELFCLQYSQFIQKFKSADA
FT                   PFKDYFNPITEGITALVNRRSTHHPSQHLPAGRLRRVQHFILDLIDVLDPHYLGKASAR
FT                   SQRVYSAPCCDCSECRREAGSYGTDSGTS"
FT   CDS_pept        join(222156..222638,222773..223132)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192907" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875703"
FT                   /orf_name="An01g00930"
FT                   /function="thiopurine S-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK43471.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008119"
FT                   /db_xref="HOGENOM:HBG324547"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="UniParc:UPI0000EF9D4D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J5"
FT                   /transl_table=1
FT                   /translation="MTTPTDNKFKDAQAYLAKHQGDSYLKGWDLLWDKGDYLPWDRGFP
FT                   NPALEDTLVERAGTIGGPIGPDGKRRKVLVPGCGRGVDVLLFASFGYDAYGLECSAAAV
FT                   EACKKEEEKVNNIQYRVRDEKVGKGKITFVQGDFFDDAWLKEIGVPRNGFDVIYDYTFF
FT                   CALNPELRPKWALRHTELLAPFPAGNLICLESPRHRDPLAPGPPFASPSEAYMEHLSHP
FT                   GEEISYNDKGLVDADPLREPSKAGLERVAYWQPERTHTVGKDKNGVIQDRVSIWRRRD"
FT   CDS_pept        join(complement(223630..224770),complement(223396..223562))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875704"
FT                   /orf_name="An01g00940"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAK43472.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI0000EF9D4E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J6"
FT                   /transl_table=1
FT                   /translation="MVKAMNDAPAPRKRGRPRNATDDQQAPEVGTSPQIQSKFELTQGI
FT                   QRRRRQLRVAQEAYRRRKETTIANLQSRVQELESGIEELSESFLSFSNLLFEAGILQNQ
FT                   PRVTAALQKITQQYVSLARRGCDEAEQPAAPADMSPPISSTLTDTQDTISNSNMLITQL
FT                   DSLPIIGDTFPFLSDLAAQWSGLSQLPSTPPSQEQAILPFGLALSPPNISFSSIASPAP
FT                   ALNSPTILSSDDSLKQGRWTLSHLLVRQCCETGYYLLTSLPGDDSRVKAIFGKQLAINE
FT                   RNCLISGFDAVMHDDIGDTIELRTKVLNSRRDSYSPERLALSSRTWQIVNESSADEWMD
FT                   ASGVQRLLQQRGIRFQDPSSPLSSLPFNSAPQLNAVSFTKYLSLCTICLGRGPAFRKRD
FT                   VENAIRLATLNDPWAFNPICEIPSLMYNNNICLPEI"
FT   CDS_pept        join(225110..225206,225260..225555,225688..225707,
FT                   225755..225893,226089..226097,226147..226229,
FT                   226267..226294,226561..226609,226881..227009,2
FT                   27172..227545)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959658"
FT                   /orf_name="An01g00950"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An11g07790 - Aspergillus niger"
FT                   /protein_id="CAK43473.1"
FT                   /db_xref="InterPro:IPR021833"
FT                   /db_xref="UniParc:UPI0000EF9D4F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J7"
FT                   /transl_table=1
FT                   /translation="MSSFTQPVPVVACGRIPTMGKSISQHLLPEYQVIHFILSYEAAEA
FT                   ELPHLLAGRDPQSRSPNEIGTHDYSQPPRAVIFGRGYEPQQVEELKKKFAGVPKEPVAW
FT                   VRGNPADLPAGAAGPEYAQNVAADMKKGRYQGYLTFRTIRTRVNLPRPRTRSLFRQIGK
FT                   TLELYTPPRKMDRKLYKGCLLEIVLVRLSELGTLNSIQSMFTLIHQSHGNESDTVSSSS
FT                   QNVANVAISYGQNEWLEIPLGEGETNRVGDHTTQLDAEAEAEMTAKMQHRKIQNRKNQR
FT                   ARRQRGSIRRRNRHVQLPCTVSRSRLTPLTITVSDPKPTWALPRCEGDDEGEVTAGHKG
FT                   LIVWGEPYDMQNWEATPGFLAKWSWAVDGCHDLVECSNRWRRMRGEEPIRLAESLEGSR
FT                   PWRCRLAT"
FT   CDS_pept        complement(227971..228969)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19806400"
FT                   /orf_name="An01g00960"
FT                   /product="Similarity to hypothetical oxidoreductase DR2595
FT                   - Deinococcus radiodurans"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43474.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9D50"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J8"
FT                   /transl_table=1
FT                   /translation="MSRYAEAHAKPNGPGDARPTALEIIKDEGVEGKLKGEVIVITGTS
FT                   SGIGIETTRALATTGATLFLTARDVTKAQSALAGIFEPSRMKIIEMDQASLSSVRIAAA
FT                   AILAETSKIHLLVNNAGIMAIPDLRLTADGHELQFCTNYLSHFLFYKLLEPALLAAASA
FT                   DLPSRVVNLASSAHNVHGINDTDNYNFQKGGYDPSVAYGQSKTANIYMANEIERRYGSR
FT                   HLHSTSVHPGLVQTGLAQHMPPDAFKGMGHLYPIMKSVEQGAATSVWGAVGKAWKHEGG
FT                   KYLVDCAVAEPYAEGDDKFTAPGYSPYAYDVEKAKRLWIDSLELVGLRDEE"
FT   CDS_pept        join(229718..230116,230174..230217,230694..230836,
FT                   231079..231392)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806401"
FT                   /orf_name="An01g00970"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An11g04000 - Aspergillus niger"
FT                   /protein_id="CAK43475.1"
FT                   /db_xref="UniParc:UPI0000EF9D51"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7J9"
FT                   /transl_table=1
FT                   /translation="MSSSMNLRQCIEATARAFLSAYEEGSVQNDASIINRNVTADCRRY
FT                   LLPSSVPHAFGLPADFFFDTAKYQEMFGKDIKVLKFTNNIMANLIIDTEARRAAFTSVA
FT                   EVHANNGETYPAEMAWFLYFNEDGSKVKKFGSEAYRMWRDIQTSLIERPTLAILRTIIP
FT                   MAVGPHRDPPIFHFRPEREILTFSTSIQPPVLSMVRCPICQEHVALSDINGHLDSGCQT
FT                   FIATQLQSPASSTLNETDCEQRESRAIAQGTTEQHHLKNNYNSTVPLDVDRNKKRSFNR
FT                   NPTPRARNQIRDYHRLSL"
FT   rRNA            complement(232907..233025)
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="An01e00980"
FT   CDS_pept        complement(233314..233586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875705"
FT                   /orf_name="An01g00990"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g12970 - Aspergillus niger"
FT                   /protein_id="CAK43476.1"
FT                   /db_xref="UniParc:UPI0000EF9D52"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K0"
FT                   /transl_table=1
FT                   /translation="MSRVIPKRDKKRPQDRNAQRATRQRTKDCLALLELQVSQLQGGAD
FT                   KALSDELRQMRKERDELGTLADDLVTIAEATKSALESSNNEAAQT"
FT   CDS_pept        join(complement(234891..235094),complement(234656..234834),
FT                   complement(233771..234620))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959659"
FT                   /orf_name="An01g01000"
FT                   /product="Similarity to hypothetical protein BAC11036.1 -
FT                   Homo sapiens"
FT                   /protein_id="CAK43477.1"
FT                   /db_xref="HOGENOM:HBG330219"
FT                   /db_xref="UniParc:UPI0000EF9D53"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K1"
FT                   /transl_table=1
FT                   /translation="MAAMMTPGSPVRLGPGPRRRSSNLVILLLVIIALLWSLVIHQNIG
FT                   RGLHVTLDDIRDPLDAIVNNTLGFEKIFAISPAQRLDRRDAIVLASSATGFHVDFIDGL
FT                   ILDEDSAKVRQPGTHDEYLAHDLCSCFPPACECCAEVASRVTYCSFTSSNKIYRIVADG
FT                   IASALILEDDVDWDINLKMQLKGLALGSQQIPKINAPERNATTDSPYGDSWDVLWIGHC
FT                   GMKCNSSSPVQVMPHDITAMPSRYLPPYLYDAPAGTGNNVRMSCIIEKAACSAAYAITY
FT                   GASQKILAALTRLTDDDNLDFPNLLSELCHNGSLECYSSYPSLVGRWKRGRREEYSSDN
FT                   DQEAVDRQMSHSSGVMYSTLGNIEHILGGECTVRASIDDAIVPELNPDLFEVPHSFLQW
FT                   TDKKGGHERAL"
FT   CDS_pept        complement(235716..236969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217342" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959660"
FT                   /orf_name="An01g01010"
FT                   /product="Similarity to hypothetical protein Y49E10.24 -
FT                   Caenorhabditis elegans"
FT                   /protein_id="CAK43478.1"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="UniParc:UPI0000EF9D54"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K2"
FT                   /transl_table=1
FT                   /translation="MPITVSLVNQQQCYAGNDRIRGRVIFQCPTPTEIQDIRVTFSGRA
FT                   KAKVQKTKGSAAPAASYRSKCILFEKERILWHPNGDTVAPDTYEWPFEFVFPSHAQAAS
FT                   SRWPETLPFRSDANHPLPPTFAAETHDSLRKLECTIEYRVHAQVFRPQRGILGRKSPLF
FT                   SEVVHLNFLPLEARWDLKSTDSYPATYQQQKEQLFNIRSMLLLPENKGRSLKVQEKIQS
FT                   WLSPGQLPRFSFKASFSYPTRMIQSAPIPCFLDITPFMEDSSVISPPDIVMQSLSIFMV
FT                   SQTAARAAPSLMGALSGQVDERIEILSRTSLGMRVLGKVDLAQAFGHLRIRHTDVSFRT
FT                   FNISRTYRLCASFSFECAGKTSTFDVPDLPVELLANSWEPEKATQSFEGHVAEDASPPP
FT                   YASASTLSTSSITTPEKS"
FT   CDS_pept        join(238713..238872,238928..242046)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193108" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806402"
FT                   /orf_name="An01g01020"
FT                   /product="Similarity to protein SEQ ID NO:628 from patent
FT                   WO200222660-A2 - Homo sapiens"
FT                   /function="NAD+ ADP-ribosyltransferase activity "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAK43479.1"
FT                   /db_xref="GO:0003950"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG324517"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR012317"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000EF9D6B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K3"
FT                   /transl_table=1
FT                   /translation="MPWKLFRKDLSDVCLRGRFPRLSHLRLGDEDSTIAFTYSFQPSMH
FT                   IEFMVSILDATEYPDNHSYFAFAVTDNIPPAVSAILETVQCKFNGCSLETFLEGFCNYL
FT                   DQAALGREPRASSPIDDDFDAISDGEDMDWDEYPDAPQMDHSVDMKQLRTDLRAAKSAG
FT                   FKVGYLGDLEGSFIVSISCRIASLGISQDAMQMWDVCPTHFIVLLLYYPRGYRRLDHIV
FT                   SQSQTAPSPVRMYVGFCDRYKPTAVSIPETHQEFSGLGVSSSTPKSALKSSFITDPLET
FT                   LLNDRFLSIVQDRLRHGFSWTGAEIFYNDAQGKKLDTKDSKLPKYFVPEEWAKFTPGFV
FT                   KADDLSQHTAHQLSLPLIAMQYTLRRFVKCTEFCLNCHCKIDAGFEALKPYVCSSPLCL
FT                   YQYMQLGMGPKLEWEIVTQPYVVDMLVSFAYARAAQGQLTDLPSGLGMKVASTGSTLPS
FT                   WTARLDAAKMTLLAQKPHNLKVGEWILIKLANASDLPSTVSSLCSTVLQVHDQSLVEIS
FT                   QPISVGYWADPQDSLSDGLDVQVVPFRVDFDSLAGDLKQKAVMLLLDTLPDVFSMKYFI
FT                   ESSAPEHKALASWHGTICPSALYVLRWILASNRSCIVHDDNPEHQVTGMHNYMQFRLAQ
FT                   GSPDKEARFVQELNNSSNTEFPTLFAWHGSPIYNWHSILREGLNFAQQLNGRAYGDGVY
FT                   MAKDLEVSRIYCSRGSMSGAKWSRSKLDITSAISLNEVVNSPTKFKLTKPYYVVTQLDW
FT                   IQSRYLFISGGGIKAQGENKNKPSKVYKQHPDWTARGPGNEPVSIPISALGTRQSQSHK
FT                   NKDDSNGLATGHRQKKRKASTKGVCGPSESSSTTDPNDDTEIEDLRLLDSDSDGDVIGK
FT                   SRRVDASKSSHNLTRGSKTDFQPGTLQAHSFKLLGPPSYATTTATKSLQRHLKATLRIQ
FT                   DREPLHEIGWYVDPTLINNVYQWIVEFHSFDPSLPLAQDLKQKGLTSVVMEMRFPPQFP
FT                   MSPPFIRVVRPRFMSFQQRGGGHVTAGGAMCMELLTSSGWLPTSSIDSVFLQVRMALCS
FT                   TEPWPARIERDGDYPFSEAVSAYRRACQAHGWKVPDDFNRIEAA"
FT   CDS_pept        complement(242490..242972)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959661"
FT                   /orf_name="An01g01030"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An16g05360 - Aspergillus niger"
FT                   /protein_id="CAK43480.1"
FT                   /db_xref="UniParc:UPI0000EF9D6C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K4"
FT                   /transl_table=1
FT                   /translation="MTHYPVYIIRTHLAMPGPDLPSPRYHTAIFVETDPVTGSGTIHEV
FT                   TGDITSPEGMYYESKLAPQPESVENFFSRTLLGMTDAAHYPNSWDNVLREIPAPPQQKA
FT                   FNVKRMKTEPFKRLSPLEFYEAGEERRPLVKCTEWVVDKAIPALRKAGLLQSSISA"
FT   CDS_pept        243525..245264
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875706"
FT                   /orf_name="An01g01040"
FT                   /protein_id="CAK43481.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000EF9D6D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K5"
FT                   /transl_table=1
FT                   /translation="MSSDMDTQVSSGTEMGVSLPFLQAARQLNYDRLSLLIAEGHHPNR
FT                   RDENGYTALHRAILECPEDLTTVAMLLTYGANPHAVFKDRNSLREITPLHYAAIRGDVG
FT                   LVSLFLHHGKSDPAPRSLKYWTTPLEDAISNGHLTVVARFIEFFSSSQLLNKPSRGIDE
FT                   SIILSARLWYSKALSLLLEYKKHHLFPSPHGPDVLKHAFCEAIRSEACNSSVQGIGERA
FT                   GGPGDNTPSKCANLLLQAGVRFRDDEMDRLLSITCSNAHLIGVTRLLLNLGPKVTAHHI
FT                   TRAIESQSYHMVKIVTKYVITSAGEDAIKRDSEPDLIQYAASHGSLDTFEYLATELGTA
FT                   SSQSQPIATTESRKTPLIHYAVWGLRIDVVQHLLSTQGANVNEQDEYGHSPLMYAFDIA
FT                   QASDENPCLAIIQLLMQYGVDVKASSIEGLTALHLAVRLGITPAVQLLLSNGCDPNAKT
FT                   TTGSDLYLRRSPSSWSPETTARNRTPLHWAVDRLANVSYDVVRLLLHYGADMNAEDGNG
FT                   VTPLNLLLGEGWCINRAWESRMAVVNLFLTFGANIDIKDMSGITARQRIRQREAELCAP
FT                   VVD"
FT   CDS_pept        join(complement(247543..247675),complement(246879..247483),
FT                   complement(246521..246814))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653760"
FT                   /orf_name="An01g01050"
FT                   /product="Similarity to hypothetical protein YLR007w -
FT                   Saccharomyces cerevisiae"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK43482.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG330250"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="UniParc:UPI0000EF9D6E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K6"
FT                   /transl_table=1
FT                   /translation="MPRYAEDHDRYDDSNRAFLQAFMARSTMTFTQAKPVLAAIFSIRD
FT                   DEQVSPEDITEDDLQTYIAAANSAISPFDLEIRSILPQIEINNNNDPPPAPERVYALVN
FT                   TTSDALTQLATTYSADEIAFVKRILDAMFDTYNTRRQEAMVISSMQALQLAKAGAGDAN
FT                   RRESGTQQQATQGGAAQSLTMTQAETMLKQLVEQGWFEKSRKGYYRLSPRGLMELRGWL
FT                   VAAYNDEGIRKIKFCAACRDIITAGQRCGDRDCTGRLHDHCMRNFFRMQQAESCPVCKS
FT                   AWPGDRFVGERAITMSDPAAQRARRSAANTQQAEAGPSTQFTLPELDVEDEADGGEEEA
FT                   GSD"
FT   CDS_pept        join(complement(248608..248908),complement(248200..248528))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875707"
FT                   /orf_name="An01g01060"
FT                   /product="Complex: Forms a heterodimer with the spU2AF59
FT                   large subunit"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43483.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG525917"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EF9D6F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K7"
FT                   /transl_table=1
FT                   /translation="MANYLASIFGTEQDKVNCSFYYKIGACRHGDRCSRKHVKPSYSQT
FT                   ILMPNMYQNPAYDPKSKMNPSQLQNHFDAFYEDVWCEMCKYGELEELVVCDNNNDHLIG
FT                   NVYARFKYEEDAQAACDALNSRWYAARPIYCELSPVTDFREACCRLNSGEGCVRGGFCN
FT                   FIHRKDPSNELDRDLRLSTKKWLKERGRDARSVSRSPSPEPTRRRY"
FT   CDS_pept        join(complement(250223..250677),complement(249343..250169),
FT                   complement(249120..249205))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806403"
FT                   /orf_name="An01g01070"
FT                   /product="Similarity to hypothetical protein BAB09014.1 -
FT                   Arabidopsis thaliana"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK43484.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG324141"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0000EF9D70"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K8"
FT                   /transl_table=1
FT                   /translation="MPTVILGGGIIGSSIAYYLSQSQPQEEIHVIESASELFCSASGYA
FT                   AGFLAKDWFAPSLAPLGELSFNLHESLAAEHGGRQKWGYMKGVALSLGSVSNKGGARGD
FT                   DWLRAGTSRAETAAGTSQYGEPQVPEWLTQQQGAKVEQISDKDTTGQVDPLRLCRFLMD
FT                   SCTSRGVKLHCPTKASSLVRNEAGTITGVRIVNLNTKSESTIPCTNLVVCAGPWTPQVF
FT                   RDLFPFSKVALPIYPLAGYSLVLHSPRHTLEHEQKKYHGETHALFTTWPPSCGFSPELF
FT                   SREGREIYIAGLNTKTIPLPERADDSHNSVDQKEMDRLKAASVRLLGKLAEGKTESSDE
FT                   TPNLNDLKIVREGLCFRPASDRGTPFVGRIDDSLLGEGIKTATGSRKGGVFVASGHGPW
FT                   GISLALGTGKVIADLVEGVQPAVDISGLAQKFTTKKELSKVHAEDGRLRHQKLLRD"
FT   CDS_pept        join(252231..252267,252348..252661,252752..253122,
FT                   253180..253216)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15875708"
FT                   /orf_name="An01g01080"
FT                   /product="Catalytic activity: 7"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43485.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000EF9D71"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7K9"
FT                   /transl_table=1
FT                   /translation="MSKTIIVTGASRGIGLAITKYLLTAPQSHNVVVIARSREPLEKLK
FT                   EQYSKQVEVLNGDLADFSIGQKAVDLALRSFGRLDGMVLNHGMLGQVGKVKDADFEQWK
FT                   HGFDVNFISLVAFIKAGLPALRESKGKIIFTSSGAAVSAYRGWALYGATKAAMNHLALS
FT                   LGEEEPEVTTISIRPGMVDTEMQRELREDHATTLEPQMHAKFTTVHKEGKLLKPEQPGH
FT                   VMAKLVLDAPNELTGKFFTWNDKALEAFQA"
FT   CDS_pept        join(254023..254044,254113..254139,254292..254551,
FT                   254617..254736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806404"
FT                   /orf_name="An01g01090"
FT                   /product="Complex: Dr1 directly interacts with the TATA-
FT                   binding protein"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43486.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000EF9D72"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L0"
FT                   /transl_table=1
FT                   /translation="MSDREFSANDDLSLPKATVQKIITEILPPSSGQTFSKDARDLLME
FT                   CCVEFITLISSEANDISEKEAKKTIACEHVERALRDLGFSDYIPDVLAVAEEHKEQLKS
FT                   REKKQSKMEQSGLSEEELLRQQQELFRSATEKYHAAPE"
FT   rRNA            complement(255491..255609)
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="An01e01100"
FT   CDS_pept        join(complement(259823..260389),complement(256770..259709))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217239" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110556"
FT                   /orf_name="An01g01110"
FT                   /EC_number="3.5.2.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK43487.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniParc:UPI0000EF9D73"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L1"
FT                   /transl_table=1
FT                   /translation="MASTNEFRLGVDVGGTFTDVCVFTPNGETVRAKVPTTPNQTIGIR
FT                   HGIAKVRRVLKERYNWDGTFRFIHHGTTTATNAVLEGKGARTALVVTAGHKDILAVRRS
FT                   QIPGGLGAWLYYTPPEPPVPLERVVQCAERMSVSGETVVEVDGERLKGDLLELMERERP
FT                   EAVAVSLLSSYKNPAHEEAVAKIIRENYLRELSEQLASETEAIRVLKSDGGLTSVGLAG
FT                   KFPVNILMSGPAGGAKGVADAVARSTPYKNLITLDMGGTSTDCALILDGKPRIRRDTVV
FT                   DTLTVRAPAVDIHTVGAGGGSIATYMELTETLRVGPESAGAAPGPACYGKGGTEATVTD
FT                   ANLVLGYLPHTLLDGEFCLDTEAAKTAIQKLATAMDLPLRQTAENIINIVNETMYGAVR
FT                   LVSVEQGYDPRDFALVAFGGAGPLHANAVGKLLGAWPVIVPPSPGILCAQGDLTTKLSH
FT                   EQSVTFTRLVRDTSSEELQRQVDELEKHCEQIMRESCGSDWPMPLVATYEVDVRYKGQA
FT                   LTITINLLPDEIQLDDQAWRCVLQDAFNKKHQQQFGYCLPDFELELMRIGVTLVDGSSD
FT                   VELPVVPKAESSEPTSSAVIGTQIIIIEGQEQVATVWEREKITLEGIRVTGPCIITEMD
FT                   SNTLILPGYSGEIDRLGNILIQPIAKQPSPTTQHTSDSAADLMHSNPLIATLVASSLAC
FT                   IRGEMDKLMLRCSMSPAIREQQDEFNVITTAEGKMLVGQFGSFIKEFLEVWTGSIEEGD
FT                   VFITNDTYMVKGAVSHLNDVIIILPIFHEHRLIGWASQFGHLTDVGGMVPGSLSINATS
FT                   IYDDGVQIPCIKLYSRGVMNSDLVDLLCRNSRQPAWYRSDLTALVTACRMAATRISELA
FT                   TRFGTEVYLAACQELLLRNRTGLAKIVERQFDDQLSTFTDFVDDDGHGVGPWAVTCSMQ
FT                   KTSAGGLKFDWSGTSPQSEHSINFYLSETMFKMLVGYYLIAAAAPGTVINNGFHDLIEV
FT                   RIPEGTVLKPVRPAAISCRTHFLGRTMDVIQALIGQKNEAYVAAAGFSDSPHFFYSGYY
FT                   PSGEWYQLYQIGFGGVPARAAGDGLDCHCLFPAIKSIPTESIELNYPLRIEANESVADS
FT                   GGPGYFRGGNAQRTLYRFLAKGEISLHDDRWFTNHGVSKGGSRDNVRGRSCIGILAVPI
FT                   VQ"
FT   CDS_pept        join(261196..261315,261384..261485,262180..262531,
FT                   262624..262700,263299..263306,263456..263514,
FT                   263593..263747,263784..263827,263913..264025,
FT                   264243..265241,265631..265686,265748..265863,2
FT                   65941..265965)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653761"
FT                   /orf_name="An01g01120"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An11g03480 - Aspergillus niger"
FT                   /protein_id="CAK43488.1"
FT                   /db_xref="UniParc:UPI0000EF9D74"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L2"
FT                   /transl_table=1
FT                   /translation="MSVRKREMQVSDVKPTSRPFSSQHSSRRNSFPPISADPFNDPTKD
FT                   RIIKLESPIRSQEKVTLVIFPEKKGRQTNIFCSIYFIPVLNGMLVERAPTLCTLECDIS
FT                   QIRLLLLNQFAMDAIQQFLYVFPEPAPHKGTEPVEELCLGLPRTGIESLSVGLQKLGLD
FT                   TYHGWDLVFEPHGRKLQCCHELVKRNHHAPELLVAYPGAKVILNGRRDVSQIVRLARYA
FT                   LVLRALISIVSIAYTCPVTSPTGMYPNVEPQNFEDWDQGNFQGCGNCAGVEPEHPSVDL
FT                   CIIVFYFSTYLAFVGDIAITTIPYGPGPFGALLLSHPSEFTAESIFELDHPKSCHLCRL
FT                   SPAMPTPEDIDQWLEETFIVHPEAEYNVTSAEKLALSLPPSPFFKLHWVPASRELIFRT
FT                   PHWRTDGAGLMMLQDAFLTLLSSPAEEINFDGSEISRLPPTMNELFCSGFEATEETKKA
FT                   FDGEWQAVFDPSLKPLSWVKHALPGTIPGSTVRLSHKFSKDETKQLITEIKKRGITVTN
FT                   GMASAFMVTAANHATPADGRFILLNPFNVRRYLPAPWNGTAGAGATYHTGRLQSFNLED
FT                   GKDYESACRAVTEFYNRGIKDAFSFMPLLIQAATSLVDTPAEVANSGNGSASVDLSQLG
FT                   LVDDLLQTRYEGPRYTLEIEDWWTGVEFVTKKLQGYTWTRDVNVKAVYIALDSLFNFAM
FT                   QISYMLEAQARPGRGESSHMTKAVSCDPLLRTSLEFKAERYILTLRK"
FT   CDS_pept        join(complement(274300..274393),complement(273895..274227),
FT                   complement(273498..273834),complement(267081..273424),
FT                   complement(266944..266979),complement(266481..266527))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217319" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875709"
FT                   /orf_name="An01g01130"
FT                   /EC_number="2.3.1.-"
FT                   /function="acyl carrier activity"
FT                   /function="acyltransferase activity"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43489.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniParc:UPI0000EF9D91"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L3"
FT                   /transl_table=1
FT                   /translation="MQLPDTVAVPGLPVAPAAAQQTSMPMAVVGIGCRLPGDVSSPAQL
FT                   WDFLRECRSGVSEVPKDRFNIHSYRGSKDEPGTTLPLGGYFLQDDIRNFDNQFFGINNR
FT                   DAAVMDPQQRRVLEVVFETFESAGVTLDEVSGANVGVYMASFTPDYIAMQTKDPESLTR
FT                   YSNLGMGATILGNRISHVFNLKGPSCTVDTGCSSSFYALHLACNALQNGECDSAIVAGV
FT                   NLIQSPELHATVSQGGFLSPTSFCHTFDTSADGYARADGVNAIYIKRLEDAIRNQDAIR
FT                   SIIRGTAVNSNGRTPGIAQPSIDGQVAVIRKAYARAGLDPAETAYVEAHGTGTKVGDPM
FT                   EVEALSRVFRKEQRASATLIGSVKPNLGHGEASSGLSSLIKATLALEHGQIPATISVKN
FT                   INPKIKTEEWGVDVVTRMTPFPLSARGGPNRISVNSFGYGGANAHVIIEEADHKKNQVS
FT                   IRTGGTGAEIHKTARVSQLPYLLPFSANRLQSLKGRVERLSNRDLSCLSVSDLAYTLGQ
FT                   RRSQFACRGYVITRQETLAQDITVANLQVSTSNLELGSSRLAFVFTGQGAQWQGMARQL
FT                   LHYPTFASTIHQLDVELKGLPHAPQWKILDIIMDESDTCPINQAVFAQPITTAVQIGLV
FT                   ALLRSWSILAEGVIGHSSGEIGAAYVAGLLSASEAIVLAYYRGYAVTRQASTAGAMAAV
FT                   GLSSDAAFDWITRLDLADNVKVACINSPSSVTISGDRGSIEIVVTALQAKGVFARILKT
FT                   DGKAYHSHHMVSVGKLYQSLLDKAGIFAKDIVPDTAPLNTHMYSTVICKPLKRQMARTT
FT                   GYWRLNLESPVRFSEGLKGLSEWIAPNLWIEMGPHTALKLPIIQTLGQSTPYHGTLKRG
FT                   QDGSVTLLSFLGYLFVHGFRLDFSKLLRSYRNESPAKFIYDLPTYAWHYEKPLWNESRT
FT                   SRESRYRQNPRHELLGTEVPGGSPASFAWRNLLHLDHVPWLRDHRLGDTPVFPAAGYTA
FT                   MAVEALIQKALPSGTDLTSKRVILRQVALLKALPLKDDDSIELFTELRPLPISNVRDSQ
FT                   HWWEFQIFTVLDGSTYTLHAKGMIRLDCGPDGTSHAVPSPNCRLTGRSKHVWYDVIARG
FT                   GLKYYSAFQRIQEVYTPESKGTLYAETSTSSFAPEVPTGAQLYPRYFLHPTLLDTVLQL
FT                   ALIACSGGFHNGLVARVPTLLGEVSMSLAPHAPGETGIIRAKASVVGLQKHRASTYLLN
FT                   QNQQPVVQFENVEMTAFSAQERTEEVRHPMGRVHRKPDITRISEDAVFSSALAHVLSVT
FT                   DLGAFGSRSRLLAALDMIVHKKPDSRILCLAXDLSFVALACLEVLEAPVVYRRFETFSL
FT                   GRIGPDGALEVAEVRNYTVPLGLGSMAYRKATSDDQYGVCILGQGTSQAVVGHLKKHTN
FT                   ECTFFLGPCTQFPAPVPSSHLQLTDRDHGVHVLRPNPKFTSQFNHVLLVEASFMDSKLA
FT                   SHLSKELDMPVQALTLRDIPHSPILPQTLVVSVLELHKSLLSDPTAEEYDAIKKVIEHA
FT                   AHIFWISGSGVHNGFDPTRSIFTGLARALIVEQPSTRIFSLEIDPATEMSVVSRDVCQI
FT                   LQQKNEVDYEYIRDGSQLLISRVVPDERLNREFRRRHNSIPMPKPLAQVDNAYLLVPEP
FT                   GQLNSARFVQRPSSPTLPADHVLVKVACMGLNAKDVYVMAGRVSTKNATCSSEFTGQIV
FT                   ELGADVQSFKVGDRVAVMHNGHFGTYETVPWWSCIRLEEHEDLVSMAGVLVVFFTAVYA
FT                   LEYRARLEPGESLLIHSAAGAVGIATIQLAQHLGVGDIYATVGNEEKKRYLVEHFGLRS
FT                   ENIFSSHDTRFAEKIKVQTRGRGVNVILNSLVGDLLHESWDCLADWGRFVEIGKRDILD
FT                   CGKLNMSTFARGTTFTSFDLNMLNELDTPEAARQLKRTILARLLQLVRAGHVQPVQPLA
FT                   VFPVSELSAACNHFNNAKRMGKIVISFEDQTQIVPTVPVLYSTVLNPNKSYLMVGCLGG
FT                   LGRSLSRWMMNRGARHFIFLSRTGLAKPAARHFVQELKQAGARCTIVTGDVTTYEDVER
FT                   AVAAAVADAPLGGVIQAAMGLHEAIFSHMPREYWLTGTQAKVRGTWNIHQALGKLKCES
FT                   ALDFLLLTSSVTGQIGMATEGNYCAANHFLDVFARYRQSLGLRAISLGLGTISEVGYLH
FT                   EHSEIGELLLRKGIRPLPENEVLQIVDFALSSDIDQQQTVPRDRLAQCHILTGIEDTKL
FT                   QDHRKQGFTGFWHNLDNTRFSVLINALQRQASQSESGINTPASVIQTVLASGDEKQLRE
FT                   AVIQAIAKKMSNIILLPLPKLDLKLPLSDYGMDSMLSAELRQYIFNSMGVDVPFLTLMD
FT                   TATSVLSVAEMVLEELGKIIRNKNNIMIYAIIILPKLSAILALVDYLISL"
FT   mat_peptide     join(complement(274300..274336),complement(273895..274227),
FT                   complement(273498..273834),complement(267081..273424),
FT                   complement(266944..266979),complement(266484..266527))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L3 "
FT   sig_peptide     complement(274337..274393)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L3 "
FT   CDS_pept        complement(276183..277523)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875710"
FT                   /orf_name="An01g01140"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g12050 - Aspergillus niger"
FT                   /protein_id="CAK43490.1"
FT                   /db_xref="UniParc:UPI0000EF9D92"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L4"
FT                   /transl_table=1
FT                   /translation="MTWSQVSAHRWERPGDGLENYFALTASLSAAAYDGRRHYTIFTKL
FT                   QLELDMPATEVECSLKKAWVQLRYEQPQIATVHNGTTKVYEVPDDTALQAWIASTVIIS
FT                   AAANAEDLYASITPIAQATLYYLPASSQLVLRTPHDTIDGIGVIRLLDRLLSILVSPPA
FT                   EKITFGDEPSRLAPTLREILGVAEQPTPEESDRMMALWKPYIDHAPGIGPVSNLGNRPA
FT                   GQSQHARLDVPTRTTEAIIQACKAKNITVTSAVHAAYIETIKKHADPDHPSCHYVNTAQ
FT                   FNLRPYLPKHGSQYTASLGYTLFPVHLESPSSFGPTAQALNQFYRTTFADDPSKLPLVP
FT                   HMTDLLFAVTQNPEYQKGPFPRDAIPSSLGIIENHMRRSYGTNKVIVRDFMLGVDVVMG
FT                   MNMLSISTFRDQLQLVYSFNDAYHEPEHISQYLQEIVTVLTKELLAN"
FT   CDS_pept        join(277784..277994,278016..278299,278362..279267,
FT                   279665..279802)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875711"
FT                   /orf_name="An01g01150"
FT                   /protein_id="CAK43491.1"
FT                   /db_xref="HOGENOM:HBG329496"
FT                   /db_xref="UniParc:UPI0000EF9D93"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L5"
FT                   /transl_table=1
FT                   /translation="MPWGFSTQPPQRLFPLLPLFALADCCVISFGLSYCRQHFGTVTRP
FT                   GSPEADRETDGGNKAQLPPTSFTPARQVLHRILFIGSQQPSLLSFVLLVTKFTLFALAC
FT                   FTVLFMALDIPKDTPDCGEGILITSIFLIILIIIFTVLRVVSKFVTHQDWWWDDFFALL
FT                   ALPFELIVLSLVVAWRQIGLGYHMEVVAAINPEYLLTGARYLYVAIFFFDGSVCLPKIS
FT                   ALFFYARIFRTNNRTFRIHLWIVGGLTSTWLLAAWISTGLECQPIAKAWNTVLPGTCIA
FT                   QFQWYLSTAALSCMIDFYILFLPIPMIWGLQASLKRRVYLLIAFMMAYSVVVLSLGRLV
FT                   AVIQFIPIMNQDLTWHFVKYGYWSILEGSISIISISVPSCLALAKALRNTSDPKIYLDS
FT                   NKASTNSPSYISSHFGEQKDTVSWQNGHSGCGSVDKLVSDIHVSPGEYGHHRNLDIPLG
FT                   AVRIETDIEPSAGLQLSGGRFDRNDMGISQYLLNLLTTCSQILPGYYEEVSAGR"
FT   sig_peptide     277784..277858
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L5 "
FT   mat_peptide     join(277859..277994,278016..278299,278362..279267,
FT                   279665..279799)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L5 "
FT   CDS_pept        280500..281690
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653762"
FT                   /orf_name="An01g01160"
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK43492.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG329502"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI0000EF9D94"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L6"
FT                   /transl_table=1
FT                   /translation="MRSPAPLSQTSTSAPSAGSILMPSKAFTFFYTAYTLVTAPVWLAA
FT                   AAIYNIPKFLRPNAAWSWKTAITSSQSTMTMIYLTTIQRAWPKSLEAGPLGNQFIVLKP
FT                   QKTITTKTKEGQGSTQFEVYKGITCSVPGVEPLPVGAVWFPEAPAEPPRRLIIHFYGSA
FT                   YVMFGSRPGETGEVGINELSKMSGWPALAIQYRLSRDKKTTFPAALQDGITAYVYALEV
FT                   LKIPASQIVFAGDSAGGNLVVALLRYINEENPALPLPRCAILSSPWVDLSTKSIENVPR
FT                   NRNYNADYVTQDFLDWGRKAYTPEGWDSNNSWITFLGNETQLGTPVFVNAGTSEVLYDD
FT                   IMKFAENLRKKGNEVEVLETPNSCHVPYRLGKDWDLEEEQAICLATMTKFLEKTGA"
FT   CDS_pept        283362..284579
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806405"
FT                   /orf_name="An01g01170"
FT                   /product="Similarity to hypothetical protein BAC47708.1 -
FT                   Bradyrhizobium japonicum"
FT                   /protein_id="CAK43493.1"
FT                   /db_xref="UniParc:UPI0000EF9D95"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L7"
FT                   /transl_table=1
FT                   /translation="MKTFTSALIGAAALAQNVNSSLLSGPAGLEFPNVTGLMNHTVHVS
FT                   NGGSAHCISGIVKVNATTDKNLKFAYNLPSNQSQVTRTLVSLWSSGGDGYVKSLTSGTQ
FT                   RITGSYDIEATYCLPAGENSKTTKVQLLTHGIGVDRHYWDFASGYSYVDTAAAAGYATF
FT                   LYNRLGVGASSKEDPLNAVQSPLELEILEALASKLRQGTLGDRAFTTVVGVGHSFGSIL
FT                   TQGVTAAYPKTLDAAVLTGFTLNSNGLPGFGLGLNAAIASETQPYRFSGLSTGYLVAGT
FT                   PVSNQIAFFYDPGFDPEILSLADATKGSFTLGELFTLTHVINATSEFQGPVAVVAGNED
FT                   LPFCNGNCSSPSNILAGLVPALYPEVSEENTATYVAPAVGHALNLHYAAPGAFNFIQDF
FT                   LKKHNV"
FT   sig_peptide     283362..283406
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L7 "
FT   mat_peptide     283407..284576
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L7 "
FT   CDS_pept        join(complement(287428..287600),complement(286625..287301),
FT                   complement(286188..286565),complement(285933..286156))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169152" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110557"
FT                   /orf_name="An01g01180"
FT                   /function="chromate transmembrane transporter activity "
FT                   /protein_id="CAK43494.1"
FT                   /db_xref="GO:0015109"
FT                   /db_xref="HOGENOM:HBG325611"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniParc:UPI0000EF9D96"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L8"
FT                   /transl_table=1
FT                   /translation="MPAQPTRHAQKSPFLNAWARSCDIPGIWDLRLLGVRRFISRFFTR
FT                   GLSNRKSGLMSRRFTPVSSRPYWHLSYGGMSTALIASLAIRNDGLISFTSLPGAVGMYA
FT                   LSLGVQRIDETLPAAVYALLSGLNASTVGIVALAAVQLAEKAIRDKIARILVIFGACAG
FT                   LCYSALWYFPVLMVAGGVTTALWDGWIYQQILRARMAWKNRNRQPEPEGDEPGSAGRES
FT                   SSMQSPEQGARIEMLRMRKSGAEASPPNSTNIQAPEGGEAAPAWEHIIRIRVGAAILIF
FT                   FFASFIAILVTRAKLSAPPLSLELFANMYLAGTVIFGGGPVVIPLLRSYVVDPGWVSSR
FT                   DFLIGLAIIQAFPGPNFNFAVFLGALAVRTTSYPTVFGAFLCGLGIFFPGITLAVAIQS
FT                   FWRVLRKQVYSVGLVFTAVYRLWEIGYLTPQDRDGQSLAKEPWWVVIAAVTYAQSAWFK
FT                   VPPAVAIVLGAVLGLCWYEVVSPAW"
FT   CDS_pept        288459..289091
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234460" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875712"
FT                   /orf_name="An01g01190"
FT                   /product="Similarity: the predicted A. niger protein
FT                   contains a phosphoglycerate mutase motif "
FT                   /protein_id="CAK43495.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0000EF9D97"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L9"
FT                   /transl_table=1
FT                   /translation="MALKVHLVRHAESVHNVTHDFSQLDPELTPLGLQQATGLGQLFPY
FT                   APQVGVIITSPLKRAIQTTLTAFSHILDKRYFDPDSGDGVENGAVLFLEPDLQERSALP
FT                   CDTGSPTRVLEAAFPRLGFQDLAEGWQVKEDFYSPADEAVEERAQRMRSRIAAVCEDLQ
FT                   HQGRTDVVVVTHGVFMKFLSGDPDIDLPKAGWRSYAVGTGTVFSKCS"
FT   rRNA            complement(289333..289451)
FT                   /gene_name="5S ribosomal RNA"
FT                   /locus_tag="An01e01200"
FT   CDS_pept        join(complement(291186..291551),complement(289556..291127))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806406"
FT                   /orf_name="An01g01210"
FT                   /EC_number="3.4.19.1"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK43496.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniParc:UPI0000EF9D98"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M0"
FT                   /transl_table=1
FT                   /translation="MVTDPNDKAQLNLQALADLQVPRDLSISPDGSRIAYALQPLSKKG
FT                   DHATSSIWIATVDKEYSSRQFTSGLFNDEQPQWSPAGTLIAFKSDRHRPGKSSAIYVLP
FT                   VDGGEAYPVTPVDCEKPIKTEEQVSKEKVKMIQLFGGKDLEYSRLRIAHVATGQIRTIV
FT                   AGHRHVHDFTWSPDSTQICFVAHKGPDINSAGFYGAEILITSISGSEEKLVAQFPGPIS
FT                   QIAWGNCGVFFIAGHVPTHCLTSLSLYELNIEYGSYTERKDGDEAHCCITLRKNQSCLS
FT                   YRVQRYLNDEFFSISDDGTRTKAYSEKCEMSSFDVLKTTDSSDIIAITRGDGSNPEEVF
FT                   SISKSTGPVKLSAHNSSIAALEISKSWSISNYARDGYYLDGMMYVPSAYKFEDGPLPTI
FT                   LIPHGGPYWRVTTGFAVCHCLEVPVLVSMGYAVLCPNYRGGSGRGEAHAAYARGGVGTV
FT                   DYTDCIDLLQYSIARGSVDPARVAIAGWSQGGFLSYFAVTREEFQFRGAICGAGISEWN
FT                   SMAMMSDAYWMQGEVVGGAPWDVDTNLKPGEEDSITSPEKRWIGDTNGRRGSALWHMRN
FT                   VKTPILILHGEDDERVPLEQAIAFYRACVHNNVPVEMVTYPREGHFIVERRHLIDMWER
FT                   MRTFCYRNLQ"
FT   CDS_pept        join(complement(293299..293460),complement(293094..293234),
FT                   complement(292646..293037),complement(292065..292554))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110558"
FT                   /orf_name="An01g01220"
FT                   /protein_id="CAK43497.1"
FT                   /db_xref="HOGENOM:HBG326373"
FT                   /db_xref="UniParc:UPI0000EF9D99"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M1"
FT                   /transl_table=1
FT                   /translation="MEYTLPLVGHSLAIFIVSAVTVGLAIICVSLRCFVRLYILRAFGW
FT                   DDALVVTALALFIALGVLCMMGPEAGIGHTLADFESFSLKSGNPMDSLHALQYAMIYWW
FT                   LGQMLYLWASAVAKVAIALALLRLAVRPLHRFILWAVIGTVICIGLVFWLILLLDCRPI
FT                   GYFWGQINPLNSGTCLPTNILLIIAYIYSSLSIVCDFTLGIFPAALIWGLHMSPRTKVA
FT                   LGAILGLGAVTTPTRTSSVSFSTTPSQAGLADNADSTYQIAIWSVMETGLAIIAGSLIT
FT                   LRPLFRWFLDGSSSYRLDKPHYVRQEDYVAGGYALSSSMPNRSITQDNLKYWRPDLSAE
FT                   NPRAHGVITSVSTPLGRGHLTGSQESLTGNLPGREVRQKHQVSVLRTFTVEDKV"
FT   CDS_pept        join(295236..295568,295622..295966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806407"
FT                   /orf_name="An01g01230"
FT                   /product="Similarity to hypothetical protein SPAC869.06c -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK43498.1"
FT                   /db_xref="HOGENOM:HBG324792"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniParc:UPI0000EF9D9A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M2"
FT                   /transl_table=1
FT                   /translation="MTSRYILNSSRPILRPLLSIPKQHRSISQSPIIMAPRISEAIKTD
FT                   HREIEDYYNKILNSATEKEKIEWQNQFTWELARHSIAEELVVYPQFEKSIPDGRAMADK
FT                   DRKEHQSVKEQLKKFQNMKPADPEFESTIRALMKDLSEHIKEEESQDLPKLEDAVSAEE
FT                   SEKLSKSFGRTKMFVPSRSHPSAPDKPPFETAIGLMTAPIDHLADLFRKWPHTSGMPNP
FT                   STK"
FT   CDS_pept        complement(296229..>296786)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110559"
FT                   /orf_name="An01g01240"
FT                   /protein_id="CAK43499.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000EF9D9B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M3"
FT                   /transl_table=1
FT                   /translation="ISGMLLTTLGYGLFIDLPSTKSWPRIILFQIVAGLGIGPNFQATL
FT                   IALQANTTPAELSRGTGTFSFVRQLAAAISVVVGSVLYARAVSGQRGALAAVLGETVAQ
FT                   EIVEASTAAAAIVETLPVGEDRTVVFHALTAALRWVWVFYTAVAGVGFLLSLCLRDLRL
FT                   GDAHRMAPGQESEELEMERGTT"
FT   mat_peptide     complement(296232..296720)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M3 "
FT   gap             296789..296888
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(297930..298115),complement(297834..297863),
FT                   complement(297350..297782),complement(<296889..297292))
FT                   /pseudo
FT                   /gene_family="HOG000160991" [ FAMILY / ALN / TREE ]
FT   CDS_pept        complement(299013..300797)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000120896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875713"
FT                   /orf_name="An01g01260"
FT                   /product="Catalytic activity: beta-D-glucuronoside + H2O  "
FT                   /EC_number="3.2.1.31"
FT                   /function="beta-glucuronidase activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK36851.1"
FT                   /db_xref="GO:0004566"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG474923"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EF9DBD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M5"
FT                   /transl_table=1
FT                   /translation="MLKPQQTPFRDIVSLDGIWKFALGSSDNETATPWTAPLATDLECP
FT                   VPASYNDIFVDRQIHDHVGWVYYQRQAIVPRGWSQQQYLVRVDAATHKGRIYINDHLVA
FT                   EHVGGYTPFEADITSLVSAGDSFRLTIAVNNVLTHETIPPGRIEVLEYTGKKTQVYQHD
FT                   FFNYAGLARSVSLYSVPKQHIQDIKVVTDVNGATGQIKYLVTVTNATTERIKIDVVDED
FT                   GRTVAEASGTHGNVTIDSVRLWQPGDAYLYQFRVSIVGLDDSILDTYSVATGVRTVKVS
FT                   GNKFLINDKPFYFTGFGKHEDSNVRGKGYDAAYMVHDFQLMNWMGANSFRTSHYPYAEE
FT                   VMEFADRHGIVVIDETPAVGLAYSIGAGVSSEDSPQTFTPEGINNNTREAHKQAIRELI
FT                   ARDKNHASVVMWSIANEPASQEAGAREYFTPLVDLAHELDSDRPICFANYGDATYEVDR
FT                   ISDMFDVLCLNRYFGWYSQTGEIEEAEAALETELLGWEGKYDKPIVMTEYGADTLAGLH
FT                   SVLGLPWSEEFQVELLDMYHRVFDRVESVVGEHVWNFADFQAVVGVGRVDGNKKGVFTR
FT                   DRKPKAAVQTLRSRWSQL"
FT   CDS_pept        join(302329..302431,302714..302871)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653763"
FT                   /orf_name="An01g01270"
FT                   /product="Remark: the ORF is short in length "
FT                   /protein_id="CAK36852.1"
FT                   /db_xref="UniParc:UPI0000EF9DBE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M6"
FT                   /transl_table=1
FT                   /translation="MATPPPTDTTSLDKTVGKREELLSDTAMTILTQLKELQNCLESQK
FT                   RTIIHIEQDDALSDQQHESHMIIPRMKARLESRKGCGYFES"
FT   gap             303956..304055
FT                   /estimated_length="unknown"
FT   CDS_pept        complement(304266..305921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806408"
FT                   /orf_name="An01g01280"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43500.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG330720"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9DBF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M7"
FT                   /transl_table=1
FT                   /translation="MPSDPSDLTALKPPTTATSQVDSESPLHETKVVSHRDTDRDSDAH
FT                   EKYIDGVLLHVIVLCLAVAMFLVSLDTTIISTAIPQITDEFNSTADVGWYGAAFLLGSA
FT                   VTQAPWGKLYGLFDIKWTYLLSLLMFELGSLLCAISHNSPTFIIGRAIAGIGGSGIGSG
FT                   IYTVIGVCVPPKKRPILVGVTGLAFLLASFAGPVIGGEFTSNLTWRWCFWINVPVGGAT
FT                   FAVLLLLFRPPFRRANVGVSRKEIILQLDIPGVITLRGALLCFLLSLEWGVSKSWHDRD
FT                   VIGCLVGFPILTGLFITNEFFWDDRAMIPRRLLLKKEVVVNLIVIFLLAGAFFMLLYYM
FT                   PIYFQTVKGNSAQDSGIRTLPLIVSAGVMAVFGAIGFGISGYPTPFLLFGAMLISVGAG
FT                   LLYTLDLVTLSSHWIPYQILAGLGIGAALQVPIIMNQATVDESDMSTMTSITLFFKCLG
FT                   ASVFMQTGQTIFLEKVKRNLDMMTVADVNPNQILTGGLVRVQAIDSASSIALRTAYLGG
FT                   LKDVFLLVAALSGLAALLASLMGRYKMDTARLRL"
FT   CDS_pept        join(307727..309162,309193..309838)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000220823" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110560"
FT                   /orf_name="An01g01290"
FT                   /EC_number="5.4.99.-"
FT                   /function="intramolecular transferase activity "
FT                   /biological_process="hopanoid biosynthetic process "
FT                   /protein_id="CAK43501.1"
FT                   /db_xref="GO:0016866"
FT                   /db_xref="GO:0019746"
FT                   /db_xref="HOGENOM:HBG535807"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR006400"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="UniParc:UPI0000EF9DC0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M8"
FT                   /transl_table=1
FT                   /translation="MAHQETMASETSISLHTLACDATKLAGTYALRQVREDGHWYGEMK
FT                   SNATITAEYVFLAQALGFSIEEDRDDLIKYFLSEQNTDGSWSLAYDFPGDVSVTAEAYF
FT                   ALCLLGLDRSHPAMASAREFTLSKGGIAKVRVFTRMFFACFGLFPWSAVPELPAELILL
FT                   PAAAPMSIYQLASWARATVVPMLVIRHHRPIYALPNGRSSSNEYLDELWVDPTDKMVPY
FT                   SPSLWSLWNDDLTAFGFTLADNILKALGGLRWFPSRKIALRHCVAWILERQEPEGDIGG
FT                   IFPPLHAALFALALEGYGLESSPVRRGIDALQNTYAWRDSTGLRIQGCISPILDTILMT
FT                   IGLIDSSLPAESPLVARSSRYLKAHQQLGNEGDWRVYNGNVPSGGFNFEYFNSWYPDID
FT                   DTAAAILAMVKQDPNLLDLGPILSAVQWILGLQNDDGGWAAFDRENNYLFLNKIPFSDM
FT                   DSFCDPSTADVTGRVIECFGLNGKNPIPRFFIDDMSSATERAIDFLSTEQEADGSWYGR
FT                   WGSNYIYGTSAVLCGLVYHLEGWDDTYPVMEKRHKVDTHAALDWLKRHQNPDGGWGERL
FT                   ESYYEPRLAGNGPSTASQTAWALMGLLAYLAPTDESITRGIQYLSRTQIKEGELAGSWK
FT                   EDHYTGTGFPNHFYLCYTLYSQYFPMMALGRYTSLSGYRPLENLESTVEDHKGNSSDC"
FT   CDS_pept        join(complement(310784..310988),complement(310346..310397),
FT                   complement(309947..310232))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875714"
FT                   /orf_name="An01g01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43502.1"
FT                   /db_xref="UniParc:UPI0000EF9DC1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M9"
FT                   /transl_table=1
FT                   /translation="MRLLTYLLLTIYATSAVSTDLSVEEECGSLGVMKVDPADLPEGVT
FT                   LADVRKCADHPLGHLPHPGAATGGWHHPPSPDPPASPSPARDAPPAKRLLDEDIDGALD
FT                   LPALAIAPAVIEIGAIPPQQCTRAHHRARSNVYPRKPHRSVPQHGPIFDDNGLPAQPVH
FT                   RAQARPIAKHHIVPNIH"
FT   mat_peptide     join(complement(310784..310940),complement(310346..310397),
FT                   complement(309950..310232))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M9 "
FT   sig_peptide     complement(310941..310988)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M9 "
FT   CDS_pept        join(complement(312007..312317),complement(311854..311953),
FT                   complement(311706..311804),complement(311419..311610))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110561"
FT                   /orf_name="An01g01310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43503.1"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI0000EF9DC2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N0"
FT                   /transl_table=1
FT                   /translation="MIFSFAPIIGLLSLISPVIATTDPLNYRNIPGYVTSSSLNVTTLV
FT                   DFIKSRSDLSILSEKIDELGGFAQAFDTDPNWKFTFFAPNNDAFELYTGAYFDSFEPTP
FT                   KGKWWLGNTIIHHYVPNSRLTSSSFNETLQRFQTATYLFVGSQMQDGAIVLNQVANVVE
FT                   SDIPVTSTHQHRSSNPTFHGCHKHSLQGVARILSSHIVDFSQPLRIGQACPELLVIIRM
FT                   SCCVVDPAKRN"
FT   mat_peptide     join(complement(312007..312257),complement(311854..311953),
FT                   complement(311706..311804),complement(311422..311610))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N0 "
FT   sig_peptide     complement(312258..312317)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N0 "
FT   CDS_pept        join(312690..313296,313361..313457,313509..313924,
FT                   313993..313997,314070..314120)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875715"
FT                   /orf_name="An01g01320"
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK43504.1"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG424315"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EF9DC3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N1"
FT                   /transl_table=1
FT                   /translation="MMKRKSQLSSFTLVTAAILPFAHFVMGGTSLAQKPQMGWNSWNAF
FT                   KATVNYTIVQEVISLFDTLGLKEAGYEYVLLDDGWASYNRTSDGYLQANATSFPQGIKA
FT                   LAQEVHGKGLKLGLYGDSGHYTCAWRPGSWGYEERDAQTFAGWGVDYLKYDNCGGFQSM
FT                   TEAPQIRFGAMKNALTLSGRDIFYSVCGWGYQFPWHWGGDIGHSYRMSGDITTSFTNET
FT                   ECQCKTAYCLNTGQYQTPGHWLDMDMLEVGNANFTLNQQQTHFAFWAALKSPLIIGADL
FT                   SKLSNDSLAVLTNKAIISINQDALGEPVTYREAHSKEGLFQVWAGKVEDGYVVLLLNEK
FT                   SYPQTVSLSFASLGLGSPQKVTELWSGQTLQDLSMISANPQSRQIDILNIK"
FT   sig_peptide     312690..312785
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N1 "
FT   mat_peptide     join(312786..313296,313361..313457,313509..313924,
FT                   313993..313997,314070..314117)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N1 "
FT   CDS_pept        join(314474..314546,314593..314644,314786..314841,
FT                   315138..315295,315362..316360,316422..316981,
FT                   317039..317832,317933..317976)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875716"
FT                   /orf_name="An01g01330"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43505.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EF9DC4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N2"
FT                   /transl_table=1
FT                   /translation="MSLQSRLIVATVHSTTLVSREWHVVDAKFWFLLLVSDRWTDWFLM
FT                   THSLTRRESLVLLRILPGHYLFNYVDPLPIRLSIKHIEPLAKSFWENLRRRTLAGNYPA
FT                   RRQEADWRSIAGKTIPPWGRRSLCMPDSVCQTSPSWRQCSHGKFLNNLNSAYPMPPKSH
FT                   PATANANVGDLPETTNKGEEEIPACQFCRKKKAKCNRAQPCSQCMRSDVLCVYDDRRTK
FT                   PGLRAGAVDQLYRRVETLENMFLGQEMLWQQMWKALFPNTEPPRSLDKGTTAATTLTER
FT                   REQLKASLQEPPPLAAKRSLTVADADNSAPLDCVPLPAKRARVEDEVAPHAAVLEPEPF
FT                   LANSLPDIVLNELVDFYFVNIHPWIPILHVKRFRERMRSPEERGHINCILHAIISVCAR
FT                   FSQNGPNGDTLNLKEIAKKSRQEVILQSTETFSVENLQALVIVAFETINRGRGPSSWSI
FT                   IGSMAGTVEQLQLGVEEDDLYRVKRMGERLIRRMVCLTPSRSWSEAEERRRVFWAVFLM
FT                   DRFCSVSTGWKISLRNADVKRRLPCEGALWEKEQEVCTPYFGISDFKNTSMPNSHSTSM
FT                   DGSEEQAIGAFAYIIEATESLALVTNFYLHHVFLINDASKARLWLVKFKELDLRLIQWK
FT                   IHLPPKWREACVLNEHRVMDPNLTLAHITHNTAVILLHQGIAYPPSHWQYCPIKLPSAS
FT                   SADTCLEAASEIATIANKFLSFSPIFTNPQFSFCLFIAGRTLLAHARYNRVPPSPALNT
FT                   LIANLMEISQRWTRHHDASESQQEESLAFKFATRLIEAQQNRTSASRPSLDIRTTAYSD
FT                   ESKEEMYKDPMRTNQDDLPDYESLSRPLQLASFPSQESTSCTFDPFSLAFPPLPPAFQQ
FT                   DFSPTGLDPLSFYNMQLPSESMSSPLVRGRESVITAIHGE"
FT   sig_peptide     join(314474..314546,314593..314600)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N2 "
FT   mat_peptide     join(314601..314644,314786..314841,315138..315295,
FT                   315362..316360,316422..316981,317039..317832,3
FT                   17933..317973)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N2 "
FT   CDS_pept        join(complement(319474..319617),complement(318138..319409))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875717"
FT                   /orf_name="An01g01340"
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, acting on glycosyl bonds "
FT                   /protein_id="CAK43506.1"
FT                   /db_xref="GO:0016798"
FT                   /db_xref="HOGENOM:HBG325399"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI0000EF9DC5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N3"
FT                   /transl_table=1
FT                   /translation="MSIEAGPPTTINGTEVLPTKQWARVLEALFSESLLAKVWFVASKA
FT                   MGSTTPPTFYPEYTGEDKTTYIYRTLDFWTSGFFPGSLYLLLERSTLFRDRHLILQRQT
FT                   SESILHPHPLQHEHLCRWWTANLHQNALRKDTHDLGFMITPWAMKAWTLHRDPAAYNTL
FT                   ILAAHSLASRFNESTQCIRSWDQCITKRYAYRNSSQDFLFIIDNMLNLDLLFWAARETG
FT                   CRRLYDIARAHAITTQKHHIRDDYTTFHVVDLDLETGEVKKKFTNQGYSDDSCWARGQA
FT                   WGIMGFAQTFEWTREMRFLRTARALADVFLARLPDDGVPYWDFDAPVTDTSPRDTSAAM
FT                   IAACGMLLLYKAYKKMHDVEAANHYLRAAMKLVDCTVVGYLNPPMRFEAGPASEISVYA
FT                   DQCSTHHTETRNGAEVLRVVGDVAETILTGATINNYEFAPRRWSDHGLVYADYYFLLFG
FT                   NMLLEMDLVDPHI"
FT   CDS_pept        join(320012..320266,320327..320553,320608..320686,
FT                   320747..321220,321270..321713)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875718"
FT                   /orf_name="An01g01350"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43507.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG331702"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9DC6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N4"
FT                   /transl_table=1
FT                   /translation="MASKISDMDATTADHLESTEKKDPYAADPGIEIDEATDKRLFWLI
FT                   TRRILVIQIVTYFFQSLDKGILNYASIMGIKDDAHLVGQEYSLLGTILYIGILVGEYPQ
FT                   NLLLQKFPVAKMLSVNVFIWGAIVACSAASTRFGSLMAVRFLLGFFESCIQPAMMLITA
FT                   MWYKREEQSVLNSIWYCMTGVQLMIGGLLAFGTSQYVGGVIKNWQLLFLALGCATCVWS
FT                   FFIGFFLPDSPLSAKCYSEEDKKLMVERVRHNETGIENRQFKRYQVIETIQDPIVWCCV
FT                   MLILVANLVIGGLGVFSNLIIEQFGFSLLQTELLNIAQGSWTIIVMVGSAWCSQRFQQT
FT                   CLIMILWTIPAIVGTIVILVVTPTSSNAGGMLIAFYCTQFFLAEGNMIISLITRNTAGQ
FT                   TKKSLTMTFLFVGWAVGNLIAPQIFQDSDAPRYLHGFLAHIVIYAVFIALTVLTRVILT
FT                   RRNKAKEGESSDVSHELAFQDLTDRENPNFRYVY"
FT   CDS_pept        join(complement(323257..323338),complement(322917..323201),
FT                   complement(322013..322857))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653764"
FT                   /orf_name="An01g01360"
FT                   /product="Similarity to hypothetical transmembrane protein
FT                   CAD18032.1 - Ralstonia solanacearum "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43508.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG329624"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniParc:UPI0000EF9DC7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N5"
FT                   /transl_table=1
FT                   /translation="MQILKIFLAVATAVHVHGLIQDVPSLNGPVMMVPDTPGSKDRTNQ
FT                   FQHPGLWHSHSQLELMRNNVLKGVEPWASAYTRFAKDPYSSASYEMQGPYPVISRGQIS
FT                   NYTSFHDDSRAAYQNAIMWYITRNESHWNRSTTILDAWGSNLENIIGTDRSLLIGIEGS
FT                   IFANAAEIMRWEGGWVEEGATFKGGSGLSVQLYWLFARQSIIIGQANYGMASIMGLLNF
FT                   AVYLDDVALYNYALYAYKYDRCAGFPYNYLASTGQNSEAGRDQTHVQDALQWTALAARV
FT                   VANQEYDLFALENNLIFTAAEYAGKYLMNQTVPYDASFYRCEVVLVDGPWANISAINRY
FT                   IGYQDGKTNPAAWGLIYYEALERGIEVPWTSRVKDVYDASVKGQTSPVDPFSWADLLFA
FT                   VAEE"
FT   mat_peptide     join(complement(323257..323284),complement(322917..323201),
FT                   complement(322016..322857))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N5 "
FT   sig_peptide     complement(323285..323338)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N5 "
FT   CDS_pept        join(323769..324420,324515..324541,324757..324783,
FT                   324929..324997,325127..325284,325341..325717,3
FT                   25750..326257)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110562"
FT                   /orf_name="An01g01370"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An06g01030 - Aspergillus niger"
FT                   /protein_id="CAK43509.1"
FT                   /db_xref="UniParc:UPI0000EF9DC8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N6"
FT                   /transl_table=1
FT                   /translation="MISILSLLSLPLFHNLAHAGTIYHSNFTSSLSPFSACNVESPSYS
FT                   TATDGNLTVYFDESYYDGTRDRKGAEICVFEDGTSTNVRQMTKEGWQGFSIYVPSDTYP
FT                   TDKSAIIAQQFCPGGCSSWCGTVEIVNNTLQTTHRAACSTGTTATLVDDIDRDAWHSVV
FT                   VHMRVSEESDGAYEVWWDGEQVYSVEDIDVGFGTWDDNDTLTTGWYFKNGEYCFGRSTL
FT                   ITSLALTKQNAPSESKITTSETNVNVPHYGLGEAELAKNMSSISAALVRRGTEVISARL
FT                   QTSQQPLIKEWIGIFLVFFTVFAFGLAINWVAYTCAEVIATLAAIEDPNSNSTPYIHLD
FT                   NETTNPDDPELSTITTSKPITSDFRTAINHLRTLGGGGFFSTFRGFRMYLAFIWLDAGL
FT                   ALLIPMFIPVPIHMGLVSFMTDFIGRMFLATGKRHGFIYRRMLGYQHWRRIAPVAVLHN
FT                   VVMSVTYSVNLAASRFVGRVIWVILGGEHGKGSSGGNAEGGIGVVLLIMFFLLLTVPVK
FT                   AIFTRVAASMLPEGLDPILPFDRRFGGKVIPEGGSETLSIMEAWTTFEWSARVRYFKVF
FT                   LKALALEVALGVLGGLLVIGELKWLLYSH"
FT   sig_peptide     323769..323825
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N6 "
FT   mat_peptide     join(323826..324420,324515..324541,324757..324783,
FT                   324929..324997,325127..325284,325341..325717,3
FT                   25750..326254)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N6 "
FT   CDS_pept        join(complement(329918..330565),complement(329189..329774),
FT                   complement(328498..329113),complement(326663..328439))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875719"
FT                   /orf_name="An01g01380"
FT                   /product="Function: co-expression of het-e and het-c lead
FT                   to cell death"
FT                   /protein_id="CAK43510.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000EF9DE2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N7"
FT                   /transl_table=1
FT                   /translation="MDRWRARLSRRLKRFQHEEPAADTQSTLPDCRRRDPVEHVKELSM
FT                   RGSTASISSEDSIRNKNQHEEAVPRSLPEKRRSPSNSNSPCHIKSFTGEDRKPDSGLPE
FT                   SSKSGSDEGKAENFWKEAFERLPPTSQDRLRALGYEPGAETQQAGAVDILLNDLQEKRV
FT                   LCEEKTWKYNNEIFVRDYAAKCATWVKLIGDLVVPFAPSQAAGPWGLIKVALEIPVKFA
FT                   DEMVALLGTVERVLQATYRGREYESAYATGNNDIADTLRRNLVNVYQAILELLSYSINM
FT                   LSKSTWTRILDTMFDKGSGLFSELTAKEEELAKTAQACSAATGGKTLYHLQDVRRHLPR
FT                   IETQVAESLEKLEWGEAMEILDWISPVKYGSHHNNVRGNRTPGTGEWLLQNGTFRDWEE
FT                   SSSSAVLWLRGSPGVGKTFLTSRVIDHVQDTLTRVPNDEGFAYFYCNRTEDNRTRPLAV
FT                   ARSYVRQLSASASKSSSLYIQSRLRSTYRELRMCGEDLDFKRCRTLLTESLNLYPRTTL
FT                   VLDAFDECDLTSRGDLLQLFQDLLSSSTRPVKLFIASRPDGDVQQQVRSYPNIDIQATD
FT                   NHQDIQAYISQEMLKLIEKNRAFGKLRDEIESTLSERSQGMFQWTYLQLKQLGKCMSPE
FT                   AIRECLGALPKTLDETYDRLYEEIEENPPHDRDLALRALKWVLAAREPLSRELLLEAVR
FT                   INPDVMTTELCTPITDDALLALCRNFLVIDSERDVWRVSHLSVAEYFELRRSWTTAVTN
FT                   FMVGKACLLFMLSDTCWNESIHAPNDDEELYALPLEYDFSRPFLYYVARYWPGHIANLR
FT                   YIGVSDDDLSTVTKLLEKFLGAPQDSSAQYRVWARYYSELQPVEYSLLVMCLYGPYLEV
FT                   SDRWWNEVELDLANTNDSGDTSMLLAARYGHIPTLRILLAKGGNLGIQGSSTMSTPLIE
FT                   AADRRRVETARFLLNQKADVNLKIDRMSAYRTCALEAAIMEEDSDMVQLLVSEGHADVN
FT                   MHLDNYYGSPLAVASFRNWLEGTKFLVEQGGADVNLALQYGNYGSALAAAAGSCGAYLE
FT                   TVKYLVEVRKADVNLPLPKSRYGSVLAMVAWRMKIAVRNSHCRRAANLREIVRILLAAG
FT                   ALVVLSVGKRKIVDALEASYERGCDNKRDDGNPGEDSDSDDEGPGCLYEEDADHEGVEE
FT                   AEESAKAMRVYLQRAMWQQYTSGALGRKEAKYVEAKYGQTKA"
FT   CDS_pept        join(331842..331871,331953..333381,333437..333984)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806409"
FT                   /orf_name="An01g01390"
FT                   /EC_number="3.6.1.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK43511.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG324140"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI0000EF9DE3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N8"
FT                   /transl_table=1
FT                   /translation="MPPFRDEHILIIAPGSQVTLAQLGLPESFTPARFRFPTRMFPAEK
FT                   KGEYEPYKIRERRQEVPVSNGNGTDAPKEDVEMKDAETAQQDGTVKTENDPSEQPEDAQ
FT                   KTEGQDANGEEKQGTTTEIFYEEDVTSDEGAVYPIQNGRIVDWPCFFALLTHVHNTLSP
FT                   PFHTPIMLISEPAWSARDRETITQFVFEKFKTPAFCLMDSALAVCYGYGTSTATVVDVG
FT                   KGKVNVTAVTDFLVNEHGRGIALEGCGGDYMTDRIVELLGPKGFTREMCEQLKRSNITE
FT                   LLPPGTPLPGAAATARQGANPAASASTGTKDGNAPNDNIPRGPGEGTQTGGEGNGEADE
FT                   DEGVLDVAAIVSGNTSEFLANREKEKAEKASTKKGATDQSGKPLRLPNSKKEKASFQFE
FT                   EYVRIEPEKDTPNGPGRYMRQSREIEVGVERFLAATPKQNSGDRLTSGLLEDIATQIHH
FT                   TILAVPDATKRSELWDSLIVVGNGSKVKGFTQSLLGTITQKYILSPSATMFTSEIPSNF
FT                   STPLPTGGTNTPVPSGQAGPMNHPAGHGVNPLLVAATHANNPMPGTPSMDPAMSHHRST
FT                   GHSQTPTSVKTLRPPEYFPEWKEQSNTNAPGAATTGGPGAPSGGHGMEEAVFLGAQVAS
FT                   KVVFVIDQGVSKGFMSRVEYNENGPSAIHEYTM"
FT   CDS_pept        join(complement(335021..335132),complement(334615..334949))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875720"
FT                   /orf_name="An01g01400"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   slr0318 - Synechocystis sp"
FT                   /protein_id="CAK43512.1"
FT                   /db_xref="HOGENOM:HBG326670"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0000EF9DE4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N9"
FT                   /transl_table=1
FT                   /translation="MSPIPSYSRPGRGQHFQDAYGFAEACIAGDRMEIAGQTGMSPTST
FT                   DVPPTLEEEVAQAFNNINEVILYTLEKAKPDLRASVKSGWDRVVKIRTYHVQLPQTREK
FT                   IIGLMVENVKKWCPDHQPTWTMLGIEALPFEGQNLEIEVDVFLG"
FT   CDS_pept        join(complement(335797..335911),complement(335563..335738))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875721"
FT                   /orf_name="An01g01410"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01460 - Aspergillus niger"
FT                   /protein_id="CAK43513.1"
FT                   /db_xref="HOGENOM:HBG331372"
FT                   /db_xref="UniParc:UPI0000EF9DE5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P0"
FT                   /transl_table=1
FT                   /translation="MKFIPALGALALAASANAAVTGNCTPGLDYCSSVLGDVGGNDAAI
FT                   VDALNRAGQGGNAPWSGYLFHCNADKSLTASVCVFGCANQGAGQSDMCFGL"
FT   mat_peptide     join(complement(335797..335857),complement(335566..335738))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P0 "
FT   sig_peptide     complement(335858..335911)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P0 "
FT   CDS_pept        join(complement(337659..338198),complement(337537..337604),
FT                   complement(337462..337487),complement(337168..337395),
FT                   complement(336861..337093))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806410"
FT                   /orf_name="An01g01420"
FT                   /product="Similarity to integral membrane protein PTH11 -
FT                   Magnaporthe grisea"
FT                   /protein_id="CAK43514.1"
FT                   /db_xref="UniParc:UPI0000EF9DE6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P1"
FT                   /transl_table=1
FT                   /translation="MHLRCPSDAYHPGCRQNMKKGCLPSKDLDIAGDRSESVRMERNYV
FT                   SASQVQATGYTMIALSSAVVIARFSLIFWKLRSLQVEDGCILLSWACFLAMSIAYIIVT
FT                   PVVYKIDAYTDGKIGPWATMLSDALFMIKVFFANTMLLWASLWSVKLSFLFLYRRLLQD
FT                   LPGEMKWWYAVLFFCIVDLYWGSYLQLYLMPKYACMVHRWGVQYTPRCFALPGFYQNTM
FT                   LSEQVMVLPLRLVVSLRLPLGQKISVAAVFALGTICVIMAVVRVIQIGTRANNDSTPSS
FT                   SWLAFWAVIVGCLPAFAIIYRRTKNTHRYRSSYVGMSSSAYVPQDDVALSEIITDRENA
FT                   GTEDVGLKAFNTTPELPMELSGEE"
FT   CDS_pept        join(338420..338602,338717..339137,339189..339250,
FT                   339309..340232)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161934" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875722"
FT                   /orf_name="An01g01430"
FT                   /product="Function: S. lavendulae mcrA protects this
FT                   microorganism from its own antibiotic "
FT                   /EC_number="1.5.3.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43515.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG329669"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0000EF9DE7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P2"
FT                   /transl_table=1
FT                   /translation="MRAGALFIATLLARATALDNTTSRIVAKLASYGVDAYEYFNSSVL
FT                   LDSSLSTRSLGFCSELCSALPRLYPGHVLQRSTTAYSTWDASFWSQQQEEVDPACVFQP
FT                   ASTVEVAVGLLLSELTLCPFAVKSGGHAAFAGASNIQDGLTIDLVGLNSTALSRNSTIA
FT                   SVGAGNRWLDVYDWLDPMGLSVIGGRVSDIGVGGLTLGGGISFFSGFHGWACDNVANYE
FT                   VVLADGSIVDVNSDTHPDLYWALRGGGNNLGIVTRFDLTTHTQGLMWGGSRIWLEEYQS
FT                   DILHALVDFGFNSPSDPNGALIVSVAYAEGLYLFVADLEYAKPVANPPIFANFSSSGVL
FT                   EDTMAIRSLSNITLLFKESNPNGLRESYWTGTVQLDYDLATNITNMFKQELVPIQNVTG
FT                   IVPALVWQVISTNTMEHMAKNGGNALGLDPKDGPLLLINLAFMWDDEADDAAVMAVLGR
FT                   ITQKALSAAQARGLGSRYLYMNYASQYQSVVPSYGTANQARLQAVAKKYDPLQVFQNLQ
FT                   PGYFKLDGAPAL"
FT   sig_peptide     338420..338470
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P2 "
FT   mat_peptide     join(338471..338602,338717..339137,339189..339250,
FT                   339309..340229)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P2 "
FT   CDS_pept        join(341069..342041,342129..342172)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875723"
FT                   /orf_name="An01g01440"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK43516.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG323871"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI0000EF9DE8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P3"
FT                   /transl_table=1
FT                   /translation="MQMSSTHPNTSYTLAWICALPEEYEVAIAFLDEIHGIPQHQPLED
FT                   KNAYLLGRIGQHHVVMVCLPAGRMGTAAAASVAENLCRTFWSVRYGLLVGIGGGVPGVV
FT                   SGKDIRLGDVVVSVPGGGNGGVVQYDLEDGEVHHGQLNSPPEKLLSYVTLLNILMRSPR
FT                   ISGNCFREQLELLGQEYEYPAHLEDRLFCSRYWHQFEGGCEACGNNCGEIYRNKRDDTL
FT                   PAVHLGTIASGNTVVGDGVTRDMINHRYGNSILCFEMEAAGIMNALPCLVVRGISDYAD
FT                   SRKNDEWRPRAIAGACSYAKALILHIPREEVPQHENLVHVTDLDKGGYCWSLAFTER"
FT   CDS_pept        join(342903..342937,343262..345536)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875724"
FT                   /orf_name="An01g01450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43517.1"
FT                   /db_xref="UniParc:UPI0000EF9DE9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P4"
FT                   /transl_table=1
FT                   /translation="MDRGFESQRGRWSVVSRLLHSSYWPTILDSDTAASTGVSKRILTY
FT                   SWLQLIAAVLVSITGIVTPLGLYDTIGPQDNPTDVLFHYAPDTSAFGKATPSRDGYKSL
FT                   RICYADEDPDTPEGCPGAPPNRADMEDITEAYSVWPSSVSLFTSGNVSATVSSVFDVQW
FT                   RSFRSSTQIVPGASATGSVFSQGYYRQISQLILDEDLLAVEGLIVDSKAGRIGFRNHTI
FT                   PSTLPMGAEWTEDILFIEPETRCVDTNLTVDYNYDPQAQYSSYSTDDIYNTDLRNLALV
FT                   DRGGFVNLSHERYSIDASNFQEDAALYERAYNAAWRHNMLIMQYFNVTTNGSDGRAPFA
FT                   YMHSEMGKRFSLANMSSIIVEPMTVQTDSGYGSFLDVPDGFTLSGNFSSGQPENPLNLS
FT                   TYDVYAIGSEACHYPSDKALSNMSFVGVACGTVFAAPRRLDGDSLIPDTNSTWSTPLYS
FT                   CAAATKAAVREVTFRFNGTGGLDKLVIQSINEKKYKDPSELPLWGVERLKNHTLQNVRP
FT                   LWGLVSPEVGARDDISTVQRDYLWLPGYADLLTSDTIAGEPSMPGNLFYTQRLLSLFDI
FT                   ATLNQATSRYTGSGDLALYNRWFELSSSASGVEKMLGLIWTDMTANTVVGTRGWHNAPS
FT                   QTSKNSKRMSKRDVGGVSVPVTLWSRNIKYHIPYAIPAFIVLALSIALAGFTICLLILR
FT                   RTGLGQMRSYLARTSPGRILGSALHPDQAGVLASTKTWIQQVGVRKATLPGQKEDGTIP
FT                   LLDIPAAGEEGVRDRK"
FT   CDS_pept        join(347298..347415,347473..347657)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875725"
FT                   /orf_name="An01g01460"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01410 - Aspergillus niger"
FT                   /protein_id="CAK43518.1"
FT                   /db_xref="HOGENOM:HBG331372"
FT                   /db_xref="UniParc:UPI0000EF9DEA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P5"
FT                   /transl_table=1
FT                   /translation="MKLTTTAFGTFALIAAANAAVTGHCTPGLNYCSRVLEDVGGNHAA
FT                   IADGLTRDGYTSAAQYPVMWNEFLFHCNNDQSISVVGACYGSCRNNGSGQSDTCA"
FT   sig_peptide     347298..347354
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P5 "
FT   mat_peptide     join(347355..347415,347473..347654)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P5 "
FT   CDS_pept        join(complement(348273..348877),complement(348060..348180))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959662"
FT                   /orf_name="An01g01470"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An08g11970 - Aspergillus niger"
FT                   /protein_id="CAK43519.1"
FT                   /db_xref="UniParc:UPI0000EF9DEB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P6"
FT                   /transl_table=1
FT                   /translation="MPFIDFQSPSLYNLSAIGILREGPVWGVSGEHMAYLMYDSNELQE
FT                   AKTNIVTIHDDPTIIKKMIDYFYRGDYDDSPDKSHLATNPDYESPTTKAHVNIEMYNVA
FT                   DKYAIEPLMALAKKKLEYRLTLVWDNKEFIHIIEKVYGLDSPQNSKLRETIAKFAVEHL
FT                   ATLIKLPRFDEVRIEFPLFSYDFSTSLIQRMARVETKLRDHEEYFLSLPLSYIVVMFIV
FT                   FIARGSAWNVVNLSMIGKV"
FT   CDS_pept        350219..350719
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959663"
FT                   /orf_name="An01g01475"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43520.1"
FT                   /db_xref="HOGENOM:HBG329708"
FT                   /db_xref="UniParc:UPI0000EF9DEC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P7"
FT                   /transl_table=1
FT                   /translation="MASGLILNPHNLLRAAPLVSSTCTLWFAFDQDLVLNVFLHPDHRP
FT                   RSNEILPSYFNVLFRRGVVRVVGLLALSMAGGGYNILKDRRSGVVAGLQSSLSWYVAGT
FT                   VLAASHLLYVPVIAPKVLAIMEDSSKGSSTEDLEGWLTIHRVRTWTVDFAAWACFVVGL
FT                   GLA"
FT   CDS_pept        join(complement(352002..352610),complement(351211..351999))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875726"
FT                   /orf_name="An01g01480"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43521.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9DED"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P8"
FT                   /transl_table=1
FT                   /translation="MTLPTSLCYLKIDDEVIAWIAWCPICTDLEQRTAVPLPRCLTPLN
FT                   VLSSPILPYCRRIHFVMSRIQFVHFQKSRVIAIANPSNYSVPATNAANDTPETQRSEPP
FT                   ATQPYTLFTSKTRMFIVIIVGFATITSPLTATVYFPLLPMLETQFETSRQAIDITLTIY
FT                   ISFQAVSPAIFGPLSDSVGRRPTYLLTLAIYALANLGMALKSNYGVLLLLRALQSLGAS
FT                   ASFAISYGIVADVCVPSERGRMMGWVSMALNLGTCVGPIMGGLVVYLSGDIGWVFWALF
FT                   IVGILLFFVVGILLPETGRNIVGNGSDRTKVKAWXRCWWSYITAXGFLLNKKNDTRXEK
FT                   PAGNTEQSPSGQARKSIFTQLNIRMFLVPLRIIFFPDAFCCLWMHGSFYAVEYILAATV
FT                   SDIFMHTYQFNTLLTGLAYFPQGIGIIGGGYCNGRIMDYNYEAMPANIIIQLIESMAMI
FT                   CVSSQSN"
FT   CDS_pept        join(352773..353728,353783..353909)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234462" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875727"
FT                   /orf_name="An01g01490"
FT                   /product="Similarity to hypothetical protein B3E4.80 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43522.1"
FT                   /db_xref="HOGENOM:HBG325776"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniParc:UPI0000EF9DEE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P9"
FT                   /transl_table=1
FT                   /translation="MPSNSPVVIDILSGEFRVDTNLASQFPPGSQIVSAIRFGTSAWTT
FT                   TARLCVKNNIGIEKLYFLKCATGDNGRLLIQGEFNAQCELYRTMPDFVPKPYSWGEIDR
FT                   SEPKTYFLLSEFINMADRIPEPYQLCTKLARLHRESVSPTGMFGFHITTCQGNTPQNVS
FT                   WESSWTIFFSKLLKHVLDRDSAVNGVWEDLNILSQRALNYVVPRLIGVLEAEGRKVKPC
FT                   LIHADLWEGNTGTSSKTGNIYIFGSAAFYAHNEMETANWRCNYNKIHDQVYIRTYLRHF
FT                   APSEPRHEWDDRSRMYSVYYNIIYSVNHRSEGTAVRQMAYDDLYYLIDKYASFEEGIGP
FT                   RRINESERASLSDERDHTRA"
FT   CDS_pept        join(354593..354646,354697..354770,354825..355005,
FT                   355060..355767)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806411"
FT                   /orf_name="An01g01500"
FT                   /product="Function: mouse KIN17"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43523.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG717067"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="UniParc:UPI0000EF9DEF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q0"
FT                   /transl_table=1
FT                   /translation="MPRAEAGSTKAISNKIKAKGLGRLRWYCQACSRQCRDENGFRCHV
FT                   QSESHVRQVLLIGEDPKKYIEDYSKQFLDNFLNLLKTGHGEKKVHINQFYQQVIADKEH
FT                   IHMNATKWKSLSQFAAYLGREGICRVEETEKGLFVSYIDRSPEAMRRQEALLKKERQDR
FT                   GDEEQEQRQIREQIKRAQQSAKEEEEVDPEARKLQRKEGEKVKLNIGFGSKTNGDSKSE
FT                   SPKPASPEEKDSGASATPETTDAAPAPAAAAAPAPPAPQAAPKVSLSFGGGGNKPKNVF
FT                   AAAVKKNPLAGKKGPVMEQPKKMTEQERIMKQEMEAMERKRMRGSAGFPDAKRPKIS"
FT   tRNA            356717..356807
FT                   /gene_name="tRNA-Pro (AGG)"
FT   CDS_pept        join(357464..357524,357606..358423)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230247" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875728"
FT                   /orf_name="An01g01520"
FT                   /EC_number="1.5.1.2"
FT                   /function="binding"
FT                   /function="pyrroline-5-carboxylate reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /protein_id="CAK43524.1"
FT                   /db_xref="GO:0004735"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG726602"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9DF0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q1"
FT                   /transl_table=1
FT                   /translation="MAVQSLSPEGRQKTLAFIGCGNMGSAILSGLLDATRTQAGKINHF
FT                   IISTKTAASAERLRSQYAEDASRVTIAHDSNLRAMREADIIMLACKPFLAKGILSAPGV
FT                   GEALSGKLVISIMAGMTPTDILDCLSDGDRESVKIVRAMPNVAARLRQSMTIVELPETK
FT                   PLEEELVEIVTWVFEVIGKVKFLSADLFDVGTMLVGAGIGVMTVPLEGLLDGCVVEGLR
FT                   RAEALEMAAQMLSGMAALLKEGSHPAVLRENISSPRGCTIQGVMTVERAGARATFADAV
FT                   INGTRHLMGDR"
FT   CDS_pept        join(358901..359496,359589..360402)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178664" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875729"
FT                   /orf_name="An01g01530"
FT                   /product="Catalytic activity: proline dehydrogenases
FT                   convert L-proline + acceptor + H(2)O to "
FT                   /EC_number="1.5.99.8"
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="CAK43525.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG326213"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI0000EF9DF1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q2"
FT                   /transl_table=1
FT                   /translation="MRSKVLLWPKRPTPLLYYQLLHHPPVYYHAYYNTSSTSTTTTHHT
FT                   VPPPAPKTPSPAPLSALPTRTFLRSLLFTSVMASPLLKPCLSLLKYMVDSNSLLFSPAK
FT                   NPVVNYLLRRTIYDHFCAGINEREVRNTVQEMKSLGFKGVILGYARESIAKVEDVDRIQ
FT                   SAEEKQEALDRAVEEWRVGTLRTLGMCGRGNYLAVKFTGAGPAAVEALSRGDRVPPPRI
FT                   QEAMMEICDAVAAQGSRVWIDAEQQIFQGAIDAWAVDLMRKYNRVNRADAPVVLNTYQA
FT                   YLKSSTARLNEHLQLAQREGWAMGVKLVRGAYIAHDHRDRIHDTKADTDRNYDHIVESL
FT                   ITRQYPLGGEPGQPFPKVRLFVASHNGVSVRKACALYRQRAQSGLPLIPVEVGQLQGMA
FT                   DEVSLGMVEGSTDGAAPGVFKCLAWGSTEECLHFLLRRAVENQSAMERTRDTARALRGE
FT                   AWRRLGGGSVM"
FT   CDS_pept        join(361954..361965,362017..363759,363804..364094,
FT                   364140..365312)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178675" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806412"
FT                   /orf_name="An01g01540"
FT                   /EC_number="3.2.1.28"
FT                   /function="alpha,alpha-trehalase activity"
FT                   /function="carbohydrate binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK43526.1"
FT                   /db_xref="GO:0004555"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG329740"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI0000EF9DFF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q3"
FT                   /transl_table=1
FT                   /translation="MQVKFLATLLPLLLHLPAAVDGLPGKNARISASLKRHAGRDVPQT
FT                   ALNSTNVYQTKFSGVTWDEDHWLLTTTTPDQGHYQSRGSVANGYLGINVANIGPFFELD
FT                   EPVNGDVINGWPLYSRRQSFATISGFWDRQAHTNGSNFPWLSQYGDDSVISGVPHWSGL
FT                   ILDLGDDTYLDATVDNRTISNFKSTYDFKSGVLSWSYTWTPQGNKGSYAITYRLFAHKL
FT                   YVNRAVVDMEITPLTNGNATVVNVLDGYAAVRTDFVASGQEEGAIFSAVRPWGVNNVTA
FT                   YVYATLDGSDSVDLSSRRIVTDKPYVSTNSSSVAQAVDVMFTANETVRITKFVGGATTD
FT                   YFLATQETAKAACLAGLADGYVKSLQSHVGEWATIMHDHSVDRFTDPATGKLPEDSHIV
FT                   DSAIIAVTNTYYLLQNTAGTNAIVAAGGIPVNVDSCAPGGLTSDSYGGQIFWDADLWMQ
FT                   PGLVASHPESAQRFTNYRIALHYQAQANIETAFTGSKNQTSFSSSAAIYPWTSGRFGNC
FT                   TATGPCWDYQYHLNGDIGLAMINQWVASGDTAWFKNYLFPIYDAAATLYSELVERNGSS
FT                   WTLTNMTDPDEYANSINAGGYTMPLIAETLQNANKLRKQFGLEPNETWDEIAEDVLILR
FT                   ENGVTLEYTSMNGSAVVKQADIVLNTFPLTYESDNYTATNSLTDLDYYANKQSADGPAM
FT                   TYAIFAIVASDVSPSGCSAFTYHQYSYAPYARGPWYQLSEQMIDDASINGGTHPAFPFL
FT                   TGHGGANQVALYGYLGLRLHPDDTIYIDPNLPPQIPHITYRTFYWHGWPISAWSNYTHT
FT                   TIQRDSSLAPLASADLLFSNVSIKVQVGQSTASADEATIYYLPLSGALTVPNRMIGSVN
FT                   TTPGNQVQCHPVYSPDAYEPGQFPISAVDGATSTKWQPSTSDLTSLTVTLSTTAEAGAE
FT                   EVSGFYFDWSQAPPENLTVIFHDSPIGNPSTVFAAAGSNSTGYRVITSMSNIVQSKPYN
FT                   AISAEELNVVSIPTANTTTITLDAPVQKARYATLLIAGNQANETAGATVAEWVILGQNS
FT                   TSSSSAQAKRKMSARSKATLAQLS"
FT   sig_peptide     join(361954..361965,362017..362070)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q3 "
FT   mat_peptide     join(362071..363759,363804..364094,364140..365309)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q3 "
FT   CDS_pept        join(complement(367855..368130),complement(367580..367805),
FT                   complement(367114..367529),complement(366900..367064),
FT                   complement(366639..366813),complement(365658..366583))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000087851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875730"
FT                   /orf_name="An01g01550"
FT                   /product="Catalytic activity: catalases convert 2 H(2)O(2)
FT                   to O(2) + 2 H(2)O."
FT                   /EC_number="1.11.1.6"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAK43527.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG339355"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniParc:UPI0000EF9E00"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q4"
FT                   /transl_table=1
FT                   /translation="MRPIGLVGLIGLANAACPYMSRDLSARDSSDASESTEEFLSQYYL
FT                   NDNNTYLTSDVGGPIEDQNSLSAGERGPTLLEDFIFRQKIQRFDHERVPERAVHARGVG
FT                   AHGVFVSYGDFSNLTAASFLSEQGKETPMFVRFSTVAGSRGSTDLARDVHGFATRFYTD
FT                   EGNFDLVGNNIPVFFIQDAIQFPDLIHAVKPRGDSEIPQAATAHDSAWDFFSQQPSALH
FT                   TLFWAMAGHGIPRSFRHVDGFGVHTYRLVTDSGASKLVKFHWKSLQGKASMVWEEAQQV
FT                   SGKNSDFMRQDLWTSIEYGRYPEWELGVQIMDEEDQLRFGFDLFDPTKIVPEEYVPITK
FT                   LGKMTLNRNPLNYFAETEQVMFQPGHIVRGVDFTEDPLLQGRLFSYLDTQLNRHGGPNF
FT                   EQLPINQPRVPIHNNNRDGAGQMYIPLNPNAYSPNTLNSASPKQANQTTGNGFFTSPGR
FT                   TTSGHLLRSTSPTFQDVWSQPRLFYNSLVPTEQQFLIDAIRFETSNVKSTTVRQNVIIQ
FT                   LNRISNDLARRVARAIDVPAPDPDPTYYHDNKTADVGTFGTKLKKLSNLRVGFLASVQT
FT                   PSSITAAQDLATELKDDEVDVVVVAERLTDGVDQTYSASDAIQFDAVVVAPGAEGLFAS
FT                   GSVTAPQLNSTASAVSTLYPAGRPLQVLVDAFRFGKTVGAVGSGKGALQNAGIDDEREG
FT                   VVVGQTIGADFVDSVREGLRTFRFLDRFALDEE"
FT   mat_peptide     join(complement(367855..368085),complement(367580..367805),
FT                   complement(367114..367529),complement(366900..367064),
FT                   complement(366639..366813),complement(365661..366583))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q4 "
FT   sig_peptide     complement(368086..368130)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q4 "
FT   CDS_pept        join(complement(369880..370325),complement(369249..369815),
FT                   complement(369001..369082))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875731"
FT                   /orf_name="An01g01560"
FT                   /product="Similarity to hypothetical protein yxaG -Bacillus
FT                   subtilis"
FT                   /protein_id="CAK43528.1"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI0000EF9E01"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q5"
FT                   /transl_table=1
FT                   /translation="MRSFVFSSLLALTSALSVEDLYVSEAPSSPRPYILPHYENSHAVT
FT                   IDSQLYRFTVTGPSSDYAFTLMSTNAPSSSSLGVLPHIHRTHYENFFSFKGRFQLWAQK
FT                   GDGEQEARLLTQGDYGSVPRNTTHTFQILDPDTEMVGVIVPGGFEDLFYALGTNYTSGT
FT                   ETPYVPGSGNSSSSSATGPDSSTISGLQQYDVYAQLDFTPRRDIVNGSAPSDSGWHTES
FT                   DTLGAAGKPYFIANNYGPKYLNSQYGAYQIVQPLVTATQAQDTNYTLSTIIMSRQPSNA
FT                   TAPTWTAGPAAFEVLEGSVQVQIGEYETARVEMGDVVFVPKGVTYRYWNEGAQAKVLYW
FT                   RRVGVMEIQHVAGPRIPGCGGGLG"
FT   mat_peptide     join(complement(369880..370274),complement(369249..369815),
FT                   complement(369004..369082))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q5 "
FT   sig_peptide     complement(370275..370325)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q5 "
FT   tRNA            complement(371613..371702)
FT                   /gene_name="tRNA-Ile (TAT)"
FT   CDS_pept        join(complement(373209..373609),complement(372498..373151),
FT                   complement(372140..372431))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110563"
FT                   /orf_name="An01g01580"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g00420 - Aspergillus niger"
FT                   /protein_id="CAK43529.1"
FT                   /db_xref="UniParc:UPI0000EF9E02"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q6"
FT                   /transl_table=1
FT                   /translation="MNTPGTVYTPDPMDIDESMDSASSTTSSDPMDLAPLTETTQSRAV
FT                   SEIGLQPSLRPGGPDAGLTSHLRAQRYKELYPEGTPRWTKEAIQEAQARVERCKPGEVV
FT                   YTTALDGANVDFEVMTERIERNKQGVAIVGLKHFLEFFPAPTDYITPNPGTRHPSLIYS
FT                   NLALGHKFRRLDEEDTDDEDEDPTDKQIAAAHESFNSIFHAWTDSAIYKNMLATLRNLP
FT                   TIKRPVTKIIAFGCNSLCSPKLDKFARERSAYQHAFLLMLRRVLQEMAWTPTDIEILLQ
FT                   DPAYTKLDKKVLGDCGMTVLDSPKAFLLVDDESFVFSCSPDVPVRQIVMDLASPVGMIW
FT                   DAVVAESMSLDTKDPWDITIHRKINQNYNTYNLPKDKRFSMLKIYLRCSDGELSDTECE
FT                   RREEKMRNTMDFVQRNKFLVSWEKDKVQDVYSVYRRMRGSHGSDGSGRN"
FT   CDS_pept        join(complement(377836..377942),complement(377710..377801),
FT                   complement(377488..377570),complement(377260..377437),
FT                   complement(377138..377207),complement(376830..377083),
FT                   complement(376317..376776),complement(374913..376267),
FT                   complement(374518..374874))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806413"
FT                   /orf_name="An01g01590"
FT                   /product="Putative frameshift"
FT                   /EC_number="4.1.1.1"
FT                   /function="magnesium ion binding"
FT                   /function="oxidoreductase activity"
FT                   /function="pyruvate decarboxylase activity"
FT                   /function="thiamine pyrophosphate binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43530.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9E03"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q7"
FT                   /transl_table=1
FT                   /translation="MAPAHTISMPHPQLFERPRITTSEGPSFFLDYLSLTNNLRLSPGP
FT                   DEVLVNLKFSGLCHSTLHQWRDAHEGTGVVIAAGNEVEDIKIGDHVGIQWINRTCGGCD
FT                   ADKRSDFVSCPHARMTGYSVDGTFEEYCISQACHVVRLPKQFPLDIVAPIICVGTTCFR
FT                   AVLESDAQPGSLVAVAGPPGGLTTLTCQYAKARGCRVLVVSTGDDSGLLYKKKLGVEYY
FT                   IDYNCSADIVAEVQGINGNGPDAAILIEGSGALLKGALQYVQHRGTVVVMGLPPGSPVG
FT                   IDVCKLVSRMAQVKVVPYGGTREQIEEAILVFTKERFYQSCRVFALDQLPQVLKSMQNE
FT                   MPEGTSPEPALHHGGQLLGEAVIKMPHREATPKPQTIAYPPTFKSTFHQTNYNIGTFLA
FT                   YRLEELGVRDYFAVPGDTNFFLLDNLLKSPKLRMVTCCNELNAGYAADGYARVSSARIA
FT                   VVVVPYIVGSLSALNAVSGACSQYVRLIVLSGCPATGVVDSDKFLHHAPTAKNKDQALQ
FT                   AFMGVTAASVRLESVETAPDVLDDTISKCLDSSLPVYIEIPNDLAFAACTPPSPLSRKV
FT                   NWKTQPHVLKEAAEAITGIWNSSKRPVLLLGSLAGLSLPRLHIELLAEKLGCAVLCQPD
FT                   GRCIEESHPQYCGQFWAGMTNPEGEHIVMSSDLWLVIGGNWSDLHVVMSSHKQENYRMI
FT                   NVDKDWVELPDGKHIKPVNIGALVAQLIMSGMKPKTESIPRPKPLLGCLPPDETETPEA
FT                   PLTLRSSISGIQGLIKGHDTLLCDAGESWLIANHILLPPEANCHLQFPYCSIGWALPAG
FT                   FGSQLARTRGRSIILIGDGGFQMTAQAVSSMIRYKANPVIFVFNNLGYQIEASQTAMHQ
FT                   GPYNYIANWDYVKLASSFSSKPHAPSHNPYASKEDEEREGSPSMFALKIKTIGDLRQAL
FT                   DRVDEEPDKLAFLELCIQPNDVTDDLRRLGRMMADRSAEASRESQSPDTEEVDE"
FT   CDS_pept        join(380016..380337,380376..380492,380541..381448)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110564"
FT                   /orf_name="An01g01600"
FT                   /product="Function: M. auratus MCT2 facilitates the
FT                   cellular uptake of lactate"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43531.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9E04"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q8"
FT                   /transl_table=1
FT                   /translation="MADIETHARHSLDQGAHATIEKSASQVIAREEQDDTFDEKYPEGG
FT                   LQAWLVVLGSWCAMVPSMGLLNTISVLHAWTSTHQLSEYSESSVGWIFGVFSFFLYFAG
FT                   AQVAADLTTPTGPIFDSHGPLPVVIPGSIGLVVAVFCFSASTEYYQIMLSFSVLGGLSS
FT                   CCLFTPAISAIGHWFNVRRGIATGIACTAGGLGGVFFPLIILYVAPKLGFAWAMRIIGI
FT                   ICFVLCGFACLLLKTRLKPDAKRGVAIDLRALREPNYALTTLAVWMVEFAVFVPYTYLC
FT                   SYGLYANIGESLSYKLCIFLNVGAIPGRAFPGLLADRLGRFNVMAFTALVCAIMTLALW
FT                   YNAGTNDAAIIAYSVMFGFWSGAAISLTPVCIAQVCRTEDIGKRNGTTFTLVSFGTLTA
FT                   IPIAGAIQERDGGAFWGLILFGGILYLAACAAFVVARGVAGGWRLRTKF"
FT   CDS_pept        383786..383866
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653765"
FT                   /orf_name="An01g01610"
FT                   /product="Induction: expression of C. gloeosporioides CAP5
FT                   is induced by avocado surface wax "
FT                   /protein_id="CAK43532.1"
FT                   /db_xref="UniParc:UPI0000EF9E05"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q9"
FT                   /transl_table=1
FT                   /translation="MSPCSCNCCSGNCSSCSCSSCSVSNP"
FT   CDS_pept        386047..387099
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875732"
FT                   /orf_name="An01g01620"
FT                   /product="Function: S. cerevisiae ZRT1 is involved in zinc
FT                   import into the cell"
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43533.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI0000EF9E06"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R0"
FT                   /transl_table=1
FT                   /translation="MSFNPNDVDLDTADPTEIICYLNKSENDYNGQLGARISAIFVIFA
FT                   VSTAVTFFPVVAKRVPRLHIPLYVYLFARYFGAGVIIATAFIHLLDPAYSEIGPQSCVG
FT                   MTGNWADYSWCPAIVLTSLMCIFLLDFGAERYVEVKYGVCREDPEPIMTSAVDNSTVDK
FT                   ESPGNTRKGEADVEELSTSDTLIEKSFKQQIAAFLILEFGVIFHSVIIGLNLGVTGDEF
FT                   ATLYPVLVFHQSFEGLGIGARMSAIPFRKGSWLPWILCSLYGLTTPISIAIGLGVRTTY
FT                   NSGSYTANVVSGVLDAISAGILIYTGLVELLARDFLFDPHRSQDNKRLAFMVITMLWGA
FT                   GIMALLGKWA"
FT   CDS_pept        join(complement(388387..388549),complement(387878..388215))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234464" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875733"
FT                   /orf_name="An01g01630"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An09g00510 - Aspergillus niger"
FT                   /protein_id="CAK43534.1"
FT                   /db_xref="HOGENOM:HBG329760"
FT                   /db_xref="UniParc:UPI0000EF9E07"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R1"
FT                   /transl_table=1
FT                   /translation="MKSSVISALALAAGALAAPSAEIESNLEKRNPSGSFSLYAWGVAA
FT                   SGLKFFYSDVVITDTELITTATTDGVTLDSDTLFYIRPTADEILPVGFTGNGIDTPSDA
FT                   VTDDFIFYGSYLMWEESSGELSDVFRLKETNVSDVYQVYWDTSSLDESGYYYPTVKDTA
FT                   PSS"
FT   mat_peptide     join(complement(388387..388498),complement(387881..388215))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R1 "
FT   sig_peptide     complement(388499..388549)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R1 "
FT   CDS_pept        complement(389389..390429)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653766"
FT                   /orf_name="An01g01640"
FT                   /EC_number="1.1.1.195"
FT                   /function="cinnamyl-alcohol dehydrogenase activity "
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43535.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0045551"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG755066"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9E08"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R2"
FT                   /transl_table=1
FT                   /translation="MSQILITGGTGFLANTLIDVLLSRGHNVITTVRSAEKASQLRSLR
FT                   PDIPSHRLTIKIVPDISLLSAFDSAVVNNPPLTGVIHTASPFHYSIDNIKKDMLDPAVN
FT                   GTIGILRSVHKYAPTVKKVVITSSFAAMWNPSKPAGSKYSESDWNNVTWEEAVSPANAQ
FT                   GQAGYRTSKALAEREAWGFMEREKPSFGLTVMNPSLIFGPVVPGSLRNLGEVNTSNTRI
FT                   RDFVAGRFREKCPPTGSAFWVDVRDAAMAHAVALEKGGETDGKRYFLTSGGFCNREIVE
FT                   VIGEEFPEVKGGLPVGEALRDGEYPEGGPKYGFDNGASVRDLGLVYRELRESVRDTVLS
FT                   LRGVPE"
FT   CDS_pept        join(complement(391478..392273),complement(391218..391243))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875734"
FT                   /orf_name="An01g01650"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g05420 - Aspergillus niger"
FT                   /protein_id="CAK43536.1"
FT                   /db_xref="UniParc:UPI0000EF9E09"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R3"
FT                   /transl_table=1
FT                   /translation="MSNISINSPDPTPYSSPKRKQTTANAAKTFPLFSFLPAELRHQIW
FT                   QFALPEPSHPPSALLPHRKGCWVAKPIPYTGELGQVNDPNGNYEIIFDMGLLDRVQIHT
FT                   PLLHVNSESRAIAQKWASNVTAPRRNCLSEKQIQDQMYNDDDSSEDIPPFSRQFDIDCD
FT                   LLYLVPNNIVDLILGAGDRLEQPDMNGKAARVVFSLPLAVVSEEVIWLKDETLLEEIMD
FT                   LFSILGLIHLVVGEQPKWMEGGVQKWWDLEWVSKRAFVWQWMEKPTVYCAP"
FT   CDS_pept        join(complement(393483..393574),complement(393061..393388))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875735"
FT                   /orf_name="An01g01660"
FT                   /protein_id="CAK43537.1"
FT                   /db_xref="UniParc:UPI0000EF9E0A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R4"
FT                   /transl_table=1
FT                   /translation="MNEPLLTIEATPDQHVRSIQLAIEWGEAALSSAKARIHVLANYRN
FT                   AYDVTVIHSHIEEAERHLFSAMSALREARTNFQGTILPALEFWRHCMANWPDCIVAKTD
FT                   YKFPLPPVLCQPDLYPHYSASFIDLCLGVHVDPTV"
FT   CDS_pept        join(complement(395455..396565),complement(394875..395392))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234465" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875736"
FT                   /orf_name="An01g01670"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g11590 - Aspergillus niger"
FT                   /protein_id="CAK43538.1"
FT                   /db_xref="UniParc:UPI0000EF9E0B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R5"
FT                   /transl_table=1
FT                   /translation="MTSVTELAAIDEVIPEVSTTDGSNLSAESQSLSADHSNPANLWGI
FT                   LLADSSEHSGLSGSILTDDTKLSDFSESILTDDSNLSDLPESPTTNSSNFSDLRESQFT
FT                   KDTCHSDSHIHLETLPAELRVQILDLLDLEGLEALVRASPVYHDQYLLDRKRLLFACLK
FT                   ITLGNMFIDACAVQETSSLSFRRARSMDTISSFVQSLRKKRAPPPDATQIKAFTLNDTI
FT                   DMVTFYRFVLKPFARHYSEWALSNLAKEPETSHAKINEPPSITEEHRIIRALYRFQLFC
FT                   NLLGTGPHKHTDKIDIFEPWIKFESHEVLMMLESLYEPWELEEINCVNVFAQIKGLEVL
FT                   KSVTWDFHETNPKFADQNRPPTPRGAFDIKTNRGQPMIDYEDSYLIGLITQGLDHLQKI
FT                   FFEIQDHSRLVAIMEESLILRTSTFICASGLGALDYLTQDDRRIVAPSERDEREERREP
FT                   LPFRGDKVDESDGAYPPLAWTLLWKGTYSNMFGNYIPDEIPKWGYVMWDAARLERTGAK
FT                   EVLLRQFVSSFWDEDQDPRDQREFL"
FT   CDS_pept        join(397789..398165,398277..398422,398497..398582)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875737"
FT                   /orf_name="An01g01680"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01690 - Aspergillus niger"
FT                   /protein_id="CAK43539.1"
FT                   /db_xref="UniParc:UPI0000EF9E0C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R6"
FT                   /transl_table=1
FT                   /translation="MRLHSNPSITARAESDEEAEILRPLNNLHKIIREMFHEIESHHTT
FT                   IQSLREWAQMIDPLAFAKMDPWPQSLISAWEEYKFFVQLINAKKLAFVNYRSAGDEDLA
FT                   DTSDWRFKRVHLAIEWGKVALSATEARLHVLCTYQNAFENTKAIDGHIEQANANLNSAR
FT                   DAVREAGINYRRYWANMAREPPCKKGIPYEDYDEESNPH"
FT   CDS_pept        join(complement(399785..400067),complement(399664..399740),
FT                   complement(399367..399423),complement(399117..399170),
FT                   complement(399024..399050))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875738"
FT                   /orf_name="An01g01690"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01680 - Aspergillus niger"
FT                   /protein_id="CAK43540.1"
FT                   /db_xref="UniParc:UPI0000EF9E0D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R7"
FT                   /transl_table=1
FT                   /translation="MYHEVQRHGGTVASLNEWAEGIDPRTYRKMIPWHQDLINACGRYK
FT                   TYLDIINPTHEAYFEYERQIDREMLGGTTETRMRRLQRLIQGLIRILGDSHPNVDSVVW
FT                   SPPVPGLKCKERLKALVRQENAGISGLPCTSHICSINELAGVAAMPEISEHGSNLKTGN
FT                   GL"
FT   CDS_pept        join(400801..400903,400952..401316)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875739"
FT                   /orf_name="An01g01700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43541.1"
FT                   /db_xref="UniParc:UPI0000EF9E0E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R8"
FT                   /transl_table=1
FT                   /translation="MTESIVVLVVLVVLVLEAPGSTISPQIGDISSLIYVLDLSTSPPA
FT                   CLGPWFACRGGVGAARYFPHTRRMGSPRCWPSEDVGTTSPCGSSLAPVSGSSPADSAVD
FT                   GSERYFGALAKYEAWIRISQFRPLGQFGYPISLVIKHAREMFALEMAPAYW"
FT   sig_peptide     400801..400866
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R8 "
FT   mat_peptide     join(400867..400903,400952..401313)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R8 "
FT   CDS_pept        join(402426..402517,402563..402644,402841..402993)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875740"
FT                   /orf_name="An01g01710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43542.1"
FT                   /db_xref="UniParc:UPI0000EF9E0F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R9"
FT                   /transl_table=1
FT                   /translation="MSMTHDFNGLEKLDLIDDEAIIQAIRHEIPSNGFECSVKSISDSD
FT                   GVLGDERRFYIRAINDHERGHTTTQAVLATVPGCALVSPGEDTDCASLELQEQLTRGMR
FT                   DPIN"
FT   CDS_pept        join(complement(410633..410762),complement(410459..410580),
FT                   complement(409567..410424),complement(409076..409510))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000064089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959664"
FT                   /orf_name="An01g01720"
FT                   /product="Function: S. cerevisiae blh1 mutants show
FT                   hypersensitivity to bleomycin"
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK43543.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG350935"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="UniParc:UPI0000EF9E24"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S0"
FT                   /transl_table=1
FT                   /translation="MGASYSKPDPRNYNSEEKRSHREWVEDADSCSLPLYTKESAQAPP
FT                   PYHVRERASSLSLHHVQDWNETLLGNAKASIATRAALSFNRLAISSLASQPYTEVLANR
FT                   PALQSDLHIFNIKVPIEGSPITNQRSSGRCWLFASTNVYRVPLMKAYNLKDFELSQAYL
FT                   FYWDKLEEANWFFEQIITTADEDLSGRLVQKLLEDPVSDGGQWDMVVNLIEKYGLVPHD
FT                   LYPDAYHAQNSSKMNWLLTAKLREQALVLRRLVRSGDAAGLADAKERFLKEIHSMVTLL
FT                   LGPPPSPDERFVWQYYDAEGKSKEIRLTPREFGRQATSLGAVRKGSVAPARLFSLVNDP
FT                   RNEYNRLLTVERLGNVLEGRPLTYVNVEMKILKQAVISMLKAGHPVFFGCDVGKFSNST
FT                   LGIMDLDIIDLTLGFNISLGMSKAQRLVSGESAMTHAMVITGVHIEDGKPVRWRVENSW
FT                   GEAAGDKGWFVMTDRWMDEYTLQAVVDSDFVSSEVRAILDQSPKVLPRWDPMGVLA"
FT   CDS_pept        join(complement(412652..412676),complement(411539..412548))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653767"
FT                   /orf_name="An01g01730"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g06350 - Aspergillus niger"
FT                   /protein_id="CAK43544.1"
FT                   /db_xref="UniParc:UPI0000EF9E25"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S1"
FT                   /transl_table=1
FT                   /translation="MMPSRLIELQLSLLSSSIRHSTNTISTMSASPFGRFTGLPSEIRL
FT                   LIWEELVKGGSLAILRTSQAIYHDIADRLYDTFDIHLTTLLEDPWIEIRCKRLCASWVI
FT                   GRQDFLKFSDLTRVPYDKVKLVVHIYAPDPDDCGQFILLWEKISRLTRMLCHADVSRNY
FT                   YIYWCGLGYERLRHSEPSPETFISMVIRLRKHNGVDWISDGQLTSTFCTEGLGYDFNEV
FT                   LLPFCRLSRVRRFRVIPDTEEMADAADWGFVNYASAFIMSEGFVTSNDTFYSDDPEYRD
FT                   IARTFDSIEGLVDGRDDFILALDAFYLPHISGHTAALMCREHYTLLLDTMVWRKPIPEK
FT                   HYTR"
FT   mat_peptide     complement(411542..412516)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S1 "
FT   sig_peptide     join(complement(412652..412676),complement(412517..412548))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S1 "
FT   CDS_pept        join(complement(413421..413432),complement(413302..413358),
FT                   complement(413234..413249),complement(413035..413166),
FT                   complement(412935..412969))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806414"
FT                   /orf_name="An01g01740"
FT                   /product="Similarity to troponin C -Caenorhabditis elegans "
FT                   /function="calcium ion binding"
FT                   /protein_id="CAK43545.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0000EF9E26"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S2"
FT                   /transl_table=1
FT                   /translation="MSASESKGTQGFYDELKALFQQADKSGEGKLALPEFKAAVKGSSS
FT                   GSQLNDMQLEAMFNFYDEDKTGFVSFESVWKKMNSMMK"
FT   CDS_pept        join(complement(416673..416881),complement(416364..416627),
FT                   complement(415781..416312),complement(415541..415737),
FT                   complement(415351..415488),complement(415120..415296),
FT                   complement(414893..415068),complement(414649..414823),
FT                   complement(414491..414563))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110565"
FT                   /orf_name="An01g01750"
FT                   /product="Function: Rattus norvegicus CLN2 is a lysosomal
FT                   protease."
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAK43546.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG325859"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="UniParc:UPI0000EF9E27"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S3"
FT                   /transl_table=1
FT                   /translation="MKFFSTICSLTLAVSALALPTSDHVIHEKRSATPSRWEKISRVNG
FT                   TEHVLVRIGLTQNNLDRAYEYLMSVSDSVSPNYGKFWTPEEVHSTFAPSNETVNAVRNW
FT                   LIESGVDESRLVHTKNQGWIVFDATTKEAENLLHTKYYHYTDRISGFKTLAAEEYRVPQ
FT                   KIQQHIDFIKPGVLLPLTSKGPSAKHTKKYKPLKQTSVNATSLTTCDEVITPACVAALY
FT                   KIPHASGNVSASNSLGIFEEGDYYAQEDLDLFFRNFTPYIPKGTHPKPAFIDGASAPVS
FT                   VADAGAESDLDFQLAYPIVYPQTITLYQTDDYDYASGEVETDGFFNTFLDAVDGSYCTY
FT                   CAYGECGDSPTLDPTYPDNSTGGYKGQLMCGVYKPTNVISVSYGGQEADLPAYYQQRQC
FT                   NEFLKLGLQGISILFASGDDGVAGPPGDDSTNGCLGNGTIFSPAFPNSCPWVTNVGATK
FT                   LYPGKTIADGESAVVDPAGHPYSVAFSSGGGFSNIYTIPDYQAEAVAEYFKKHNPPYPY
FT                   YEGNASFGKNGGVYNRLGRGYPDVAANGDNIAEYNAGEFILEGGTSASTPIFSSVINRI
FT                   IEKRIAAGKGPLGFLNPVLYRNAWALNDITNGSNPGCGTEGFYTAPGWDPVTGLGTPNF
FT                   PKLLDVFLNLP"
FT   mat_peptide     join(complement(416673..416827),complement(416364..416627),
FT                   complement(415781..416312),complement(415541..415737),
FT                   complement(415351..415488),complement(415120..415296),
FT                   complement(414893..415068),complement(414649..414823),
FT                   complement(414494..414563))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S3 "
FT   sig_peptide     complement(416828..416881)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S3 "
FT   CDS_pept        join(complement(418756..418830),complement(418567..418570),
FT                   complement(418508..418530))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875741"
FT                   /orf_name="An01g01760"
FT                   /product="Similarity."
FT                   /protein_id="CAK43547.1"
FT                   /db_xref="UniParc:UPI0000EF9E28"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S4"
FT                   /transl_table=1
FT                   /translation="MKTLSFFFSISLLGTSLLAAAAPNCRSYITPGS"
FT   mat_peptide     join(complement(418756..418767),complement(418567..418570),
FT                   complement(418511..418530))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S4 "
FT   sig_peptide     complement(418768..418830)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S4 "
FT   CDS_pept        join(419587..419631,419954..420041,420172..420270,
FT                   420351..420423,420455..420509,420598..420687,4
FT                   21104..421358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806415"
FT                   /orf_name="An01g01770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43548.1"
FT                   /db_xref="UniParc:UPI0000EF9E29"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S5"
FT                   /transl_table=1
FT                   /translation="MSSATCQLERAGFPRNTQLEMMVPCIIPRSSQKRTPKKAKGEEDS
FT                   YRQTSYRTVYLPKQVPEGLAVKKLSNSVIRFNNIRVPLCNGYWPRKLQKVDICMIRRYR
FT                   FFSSLSTDAQKLAHTKYLGAYMAVQKTIRTPASYGRLDTASGWDCLIRNVRITIYEKST
FT                   SIKANIEVWGSGTVPRLLKKVLRARSGPPTVDCLKRLVGSRFVDVKDSSELLKVTGKTV
FT                   DRDLDMAQSSLS"
FT   CDS_pept        join(423796..423963,424029..424949)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875742"
FT                   /orf_name="An01g01780"
FT                   /protein_id="CAK43549.1"
FT                   /db_xref="HOGENOM:HBG329496"
FT                   /db_xref="UniParc:UPI0000EF9E2A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S6"
FT                   /transl_table=1
FT                   /translation="MALDIPSGTPDCGEGIMITFIVLIVLTTLFTALRVISKFITQQDW
FT                   WWDDFFAILALPMELAVLSLLTAWRQIGMGYHSEVVAAINPEYLMAGARYLYVAYFFFD
FT                   GSVSVPKLSAVFFYARVFRSNNRSFRTHLWIAGGLTSAWLLAAWISTILECRPIAKAWN
FT                   TALPGTCIAQFQWYLSTAILSCMIDFYILFLPVPMIWGLQASVKRRIYLLVSFMMAYSV
FT                   VVLSLGRLVAVVQLTPVMNQDLTWNFVPYAYWTVLEGSISVISISVPSCIALVKALRDR
FT                   PRSTVGSGSKGVCAKPINYMSLHPGARKIVNLWQKGHASSDSTDKLISDTHVSPGEYGH
FT                   RRDTYTPLMVHVETDIDVSWLL"
FT   CDS_pept        join(complement(426943..427067),complement(426536..426891),
FT                   complement(426308..426483),complement(426051..426254),
FT                   complement(425844..425987),complement(425160..425786))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875743"
FT                   /orf_name="An01g01790"
FT                   /function="inorganic anion exchanger activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43550.1"
FT                   /db_xref="GO:0005452"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG324844"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniParc:UPI0000EF9E2B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S7"
FT                   /transl_table=1
FT                   /translation="MLNPCRGMYHDVRRRLPHYWSDIRDALTYRTIASTIRIYFINILP
FT                   AIAYTLDMYRRTGEFYGINEALFSSALAAMVFSVLGAQPLTIVGITGLISLFNYTIYDI
FT                   IVIYEPAIYANFMCWTAIWAAIFHWIVAVCNLCDYMRYVTDFSSESFGAYVGIIYCIKG
FT                   VEELVNEFTVYGPTAGFMSCMIAILYFFTIYGLELVGSSTICRPWLRELLADYAYVIGT
FT                   IFWVGFAHIPGNLKATGISFVPITRAFYPTQPRGWLIHFWELETKWVFAALPFGFLVML
FT                   LFYYDHNVSSLGAQGRQYPLEKPAGFHWDFFLLGCTTFIAGITGIPMPNGLVPQAPVHT
FT                   TSLTVTETTLHIIPISDPESEGTEICRPIITPTAVIEQRISHFLMGLAIIGTMTGPLLI
FT                   VLHTMPAAVFAGVFFIVGWGSIESNGILHKIIFLLREDRFIPRNEKLLRVPRRKIMLYV
FT                   MCQVIGVAACVAISQTIAAIGFPILIIGLIPFRVWVVPRWFGVEELGVLDGLTADGEAV
FT                   LCSLGGPPRFPGEARGVEGERQKGGE"
FT   CDS_pept        join(427645..427869,427923..427994,428048..428413,
FT                   428463..428507,428554..428780,428831..429392,4
FT                   29571..429702)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216867" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875744"
FT                   /orf_name="An01g01800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43551.1"
FT                   /db_xref="UniParc:UPI0000EF9E2C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S8"
FT                   /transl_table=1
FT                   /translation="MDYIAPSLISQLSSILQNPSFPAHLQSAVHAVWHSQDSRQKSASE
FT                   ENGYPQLHLRIEASIVTDVTTSKQTSDLVLGYIDLRSGQAVPLPPTPVSTPDSTINTEY
FT                   ATISTDSNGGRDNSTAQSHPHKRRKTVSALRPAKATTIQPDESRDHEYESLDLEAAADS
FT                   SGTKPSVRQVHSDTRFPQRKNPRQEYSLPVLEPTSADKLIAGIWRQLHSPVKLSRLPSI
FT                   IQSNTDIRTGVSLEVSREINTLCLKYYNQSQSSRALEMIVQAYWIECFEARVAVVRLEK
FT                   PHLSTTDARMMVLKEACVVLNWKEKDLRNRMAIWRGYKEIKDTGGWACLIFASTGIYRF
FT                   CKYRTEFGEGLFTRLRHLQSSFEVAADTLHPGWRDLLQVIRQNTSCVYHGHPHEWVNMS
FT                   EGAAVPLASTYEHLDLPQGLQYQFIEECVLDRTHFGTHDPRRVPELDPDLCLVCKERQS
FT                   DEIQKNQCLCFPALFGGVRHPVPVQVFRTSTGKNNGVIARCVVRAVEHTKYIRGRWAIS
FT                   PDLSTTPVGRTASSNGSTGGAWSAL"
FT   CDS_pept        join(complement(432197..432302),complement(431414..432130),
FT                   complement(430258..431361),complement(430109..430218))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875745"
FT                   /orf_name="An01g01810"
FT                   /product="Function: plays a role in the entry into G0 "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43552.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG324981"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9E2D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S9"
FT                   /transl_table=1
FT                   /translation="MFAQLKLLELLHYAVLESLLHKSRINKEGFRSLLVLKIPRSSLLY
FT                   AMASATQTQEIEIGSPVSTTQNNTIGPDISTNSSTRKPPPTTVNNEQTTNSVPTANQTT
FT                   NTINNKTTITCTMLSLCLSVLLSALDLTIITTAIPSIVGTFNSATGYTWIGGAYTLAYA
FT                   AVTPIWGTVADIWGRKPVILIAMAVFLGGSLLCALAPSMDVLLAGRVFQGLGGSGMGIM
FT                   VNIIISDLFSLRDRGLYLAITSLVWAVGSAVGPVLGGVFATKLSWRWCFWINLPIGAIS
FT                   FTVLLLYLHVPNPRTPLTTGLKAIDWTGILLIVGSALMILLALDLGDVVYPWSSATIIC
FT                   LIIFGILCMGLFGVNEYKLARNPVIPFWLFSSPTKAAPYIVFACNNYVFIGLAYYLPLY
FT                   AQSVLGASALASGLYLLPLIVSCALAAAAAGVYMQQTGRYIPVMYIAQILLMIGTGLLI
FT                   DLRFETSLTRLIIFQTLAGIGVGMNIEAPILAAQAATTVRDTAAVTATMGFVRSLATAI
FT                   AVVVGGVVFQNEMTSANGALTDRLDGDGALAKEFNGDLAASNVERIGALEESEQIIVRE
FT                   TYFQALRMVWVMYVAFAGLASVITLFVRAHDLRRENEGAVLGVERGRGDSRLEEPGSEV
FT                   TVEVEMEAEDRTFRLALARLSRSGATLKALSGNNMDQIPFLMK"
FT   CDS_pept        join(complement(434690..434983),complement(434402..434627),
FT                   complement(433924..434339),complement(433705..433869),
FT                   complement(432564..433655))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000087851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110566"
FT                   /gene_name="catR"
FT                   /orf_name="An01g01820"
FT                   /product="Catalase R catR-Aspergillus niger "
FT                   /EC_number="1.11.1.6"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="CAK43553.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG339355"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="UniParc:UPI0000EF9E2E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T0"
FT                   /transl_table=1
FT                   /translation="MRHFWLLPAVAGIAGAQCPYLSGEMSFTQEQDNAGDTIEVTEQPI
FT                   DNTLYVNDTGSYMTTDFGTPISDQTSLKAGPRGPTLLEDFIFRQKLQRFDHERVPERVV
FT                   HARGAGAYGTFKSYADWSNVTAADFLSANDKETPMFCRFSTVVGFRGSVDTARDVHGHA
FT                   CQFYTDEGNYDIVGINFAPFFIQDAIQFPDLVHAIKPMPNNEIPQAATAHTSAWDFFSQ
FT                   QSTALHSALWLMSGNGIPRSFRHMNGYGVHSFRFVAANGTSKVVRYRWKSQQGVASLVW
FT                   DEAQAAAGKNSDYHRQDLYNAIANGHYPKYELQAQIMDEADMLRFGFDLLDPTKLVPEE
FT                   VVPYTPLGMMELNANPTNYFAEVEQAGFQPGHVVPGIDFTDDPLLQGRLFSYLDTQLTR
FT                   HGGPNFEQIPVNRPRKPVHNNNRDGFGQQQIPTNNWAYTPNSMSNGYPMQANQTQGHGF
FT                   FTAPYRYASGHLVRQTSPTFNDHWSQPAMFWNSLIPAEQQMVVNAIVFQNSKVNSPHVR
FT                   KNVVNQLNMVNNNLAVRVARGLGLDEPSPNPTYYTSNKTSNVGTFGKPLLSIEGLQVGF
FT                   LASNSHPESIKQGQAMAAQFSAAGVDLNIVSEAYADGVNTTYALSDAIDFDALIIADGV
FT                   QSLFASPALANQMNSTATSTLYPPARPFQILVDSFRYGKPVAAVGSGSVALKNAGIDSS
FT                   RSGVYTGSSETTEKIAKEVLEGLYTFRFVDRFALDE"
FT   mat_peptide     join(complement(434690..434935),complement(434402..434627),
FT                   complement(433924..434339),complement(433705..433869),
FT                   complement(432567..433655))
FT                   /product="catalase R catR-Aspergillus niger "
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T0 "
FT   sig_peptide     complement(434936..434983)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T0 "
FT   CDS_pept        436559..438847
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000218110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875746"
FT                   /gene_name="katG"
FT                   /orf_name="An01g01830"
FT                   /product="Catalase-peroxidase "
FT                   /EC_number="1.11.1.6"
FT                   /EC_number="1.11.1.7"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="hydrogen peroxide catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43554.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0042744"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG285610"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniParc:UPI0000EF9E2F"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q7T1"
FT                   /transl_table=1
FT                   /translation="MAEAKCPFSQSRSNANVAGGGTRNTDWWPDQLNLGILRQHAPASN
FT                   PFERDFDYTAAFNSLDYYALKKDLHALMTDSQDWWPADFGHYGGLFIRMAWHSAGTYRV
FT                   FDGRGGGGQGQQRFAPLNSWPDNASLDKARRLLWPIKQKYGAKISWADLMLLAGNVALE
FT                   SMGFKTYGFSGGRADTWEADESVYWGGESTWMGNDVRYSDGFPGVTKHGALSGDEPPHR
FT                   NIHTRDLEKPLAASHMGLIYVNPEGPDGNPDPVAAARDIRTTFGRMGMNDEETVALIAG
FT                   GHSFGKTHGAASSENVDVEPAAAGLENQGLGWSNRYQSGKGPHTITSGIEVTWTKTPTK
FT                   WSHAFLEYLFRFDWELTKSPGGANQWQAKNTEAIIPDAYDPSKKHLPKMLTTDLSLRYD
FT                   PAYEKIARRFLDHPDEFADAFSRAWFKLLHRDMGPRTRYIGPEAPTEDLIWQDPIPAVN
FT                   HTLVDANDIAALKRTILDTGLNKSNFVSTAWASASTFRGTDKRGGANGARIRLAPQRQW
FT                   EVNNQPWLEETLSALEKIQKDFNDRVSSTGKKISLADLIVLAGCAAVEKAAQEAGQTIT
FT                   VPFTPGRMDASQEQTEVESFSHLEPVADGFRNYGKSSSRVRAEHYLVDKAHLLTLTAPE
FT                   MTVLVGGLRVLNTNYDGSKHGVLTSSPGRLTNDFFTNVLDMNTAWKAKDGGRDLYEGTD
FT                   RKTGQPKWTATRADLVFGSHAELRALAEVYGSSDGQEKFVKDFVSAWDKVMNLDRFDLK
FT                   GSGIARSKL"
FT   CDS_pept        439169..440611
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221615" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806416"
FT                   /orf_name="An01g01840"
FT                   /product="Catalytic activity: RCH2NH2 + H2O + O2  "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43555.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG556224"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI0000EF9E30"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T2"
FT                   /transl_table=1
FT                   /translation="MALQLLSLLCLILTTAAFPVSEVDVAIIGAGLSGLSAAKDLAAAG
FT                   RSFAILEARDRVGGRVLNVELPGGIVEEVGAEFVGPTQDRVLALAAELGLTTYPTYNTG
FT                   NCTLLRNGTVTNYPCELGSGSLPPLTTEALIEVFTLQQQLNALAAEIDVETPWDHPNAS
FT                   IWDTMTLETFLASQLTLSDARFLLNTFVTGILATEANEPSLLYMLAYIAASGNETEVGT
FT                   LDRLIDVAGGAQESRIVGGTQLIALRLADRLGAENINLRSPVQRVLHCNGRYMINTNGT
FT                   QISAKRVIVAMSPPMAARISYDPPLPPARDQLTQRMGMGSIGKAIAIYPTPWWREQGWN
FT                   AQALADTGIIRITFDNTPADVSFGAIMGFIVGDEMRRVDKMNKTEIEAAVIDSFVGMFG
FT                   PQAAHPDRVIVQRWDWEEYSRGGPVAYAPPSVLTDYGAHLRESVDGIYFAGTEASFYWT
FT                   GYMDGAVRSGERVAAEVLRSLQ"
FT   sig_peptide     439169..439219
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T2 "
FT   mat_peptide     439220..440608
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T2 "
FT   CDS_pept        join(441440..443311,443428..443550)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875747"
FT                   /orf_name="An01g01850"
FT                   /product="Function: co-expression of het-e and het-c lead
FT                   to cell death"
FT                   /protein_id="CAK43556.1"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniParc:UPI0000EF9E31"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T3"
FT                   /transl_table=1
FT                   /translation="MRLLNAKTLKLEEFVGHDIPAYAILSHTWGEDEVSFQDMQAPTVT
FT                   EKRGYAKIEYSCERALQDGLSYVWVDTCCIDKTSSAELSEAINSMMAWYAQSRICYAHL
FT                   ADVPPITDQDFDKAAFSQSRWFTRGWTLQELIAPCELVFLAQDWSFLVARETVAEFISD
FT                   ITGISHLFLEARPDNEDLKSNLMSTSIAERMSWASERETTRTEDMAYSLLGILQVNMPL
FT                   LYGEGSAAFRRLQEEIIKHSDDQSLFAWGFGTPDHDLSHKRPWSAAQSSLAKIVSFFKE
FT                   YSAPPEATGAMDMDISDMSGILAESPAAFRGCGDIVPCDVKRPTPSFSMTNRGLSIELP
FT                   VLQLADGYFSLLQCQMKKDPTKLIALPIRRLRDNTFCRSKRGNYVASHSAWLTWSWTQL
FT                   YFIPSNDSAIARFLDSPLYSIAIKSLPPNLRIAEILPARPFRQADSMVIYTKSPGVSDF
FT                   DANIFVRFEDLGNNNLSFILLVMVINPSWARQPLPSALIPYLYLLPPPDDSSPLVRDIR
FT                   SWIRQKDREYLGPVPYSVKITTQTLSQSGLWMIDIIPESRDKKAMYLEMRKMRSWVGIL
FT                   RWVLRRDPLVENVYGKWLDYLCERGFRLSQVLMLSPLCFTFPFDLVLELVVQENQFGRY
FT                   QKLASTIHYVQMYPLTHAPFSRWGRGGLS"
FT   CDS_pept        join(complement(444900..445109),complement(444536..444751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875748"
FT                   /orf_name="An01g01860"
FT                   /product="Remark: Homology is only based on repetitive
FT                   sequence"
FT                   /protein_id="CAK43557.1"
FT                   /db_xref="UniParc:UPI0000EF9E43"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T4"
FT                   /transl_table=1
FT                   /translation="MPGGLHPPLSVMESWPARNTINPESHGSASIVLPAIFGSIAVTAV
FT                   ILRLWARCVIQRQGKLDDFFIALALEPTTTAKTTTYGTTRSPNSSSRANSPSRKNSSTS
FT                   SPRASPRSPCYFSTAAWATAPPSPLASSTSSTSASPA"
FT   CDS_pept        join(446938..447037,447085..447229,447273..447471,
FT                   447518..447758,447808..447861,447907..449703,4
FT                   49735..449784)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020380" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959665"
FT                   /orf_name="An01g01870"
FT                   /product="Function: putative cellulase. "
FT                   /function="cellulose binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK43558.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030248"
FT                   /db_xref="HOGENOM:HBG325552"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="UniParc:UPI0000EF9E44"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T5"
FT                   /transl_table=1
FT                   /translation="MRRTFAALVAGYLLDSVHAAASQAYTWKNVVTGGGGGFTPGIVFN
FT                   PSAKGVAYARTDIGGAYRLNSDDTWTPLMDWANNSNWHDWGIDAIATDPVDTDRVYVAV
FT                   GMYTNDWDPNDGSILRSTDQGDTWEETKLPFKVGGNMPGRGVGERLAVDPNDNSILYFG
FT                   ARSGNGLWKSTDYGETWSNVTAFKWTGTYFQDSSSTYTSDPVGIAWVTFDSTSGSSGSP
FT                   TPRIFVGVVDTGESVFVSEDAGETWTWVSGEPMYGFLPHKGILSPSEHTLYISYSNGAG
FT                   PYDGTNGTVHKYNITSGVWTDISPTSMTDTYYGYGGLAVDLQVPGTVMVAALNCWWPDE
FT                   LIWRSTDSGATWSPIWAWNGYPSINYYYSYDISNAPWLQDDTSTDEFPVRVGWMVEALA
FT                   IDPFDSDHWLYGTGETIYGGHDLQNWDSEHNVTIESLAVGIEEMAVLGLITPPGGPALL
FT                   SAVGDDGGFYHTSLTTAPSQYYHTPTYSSTNGIDYAGNKPANIVRSGSSDSDPTLALSS
FT                   SFGESWYADYAASSSTATGQVALSADADTILLMNSDGAYRSANSATLSAVSSLPSGAVI
FT                   ASDKANNTYFYGASGSSFYLSSDTAATFTVTTTLGSSTTANAIRAHPSLAGDVWVSTDT
FT                   GLFHSTNYGKSFTHIGSGCTEGWSFGFGKPSSDGDYPVLFGFFTVDGVTGLFKTEDQGV
FT                   NWQIISDAEHGFGSASANVVNGDLQNYGRVFVGTNGRGIFYGDPSGTLPSATATASSAS
FT                   STAVKSSTSASTSKVGSSTTVSSSTATTITTSSIKSTTLTTTTKSSSSTTSTSSTATGT
FT                   ASAYGQCGGSGFTGPTQCPSGWTCTYENEYYSQWADICRSGGMSESRAV"
FT   sig_peptide     446938..446994
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T5 "
FT   mat_peptide     join(446995..447037,447085..447229,447273..447471,
FT                   447518..447758,447808..447861,447907..449703,4
FT                   49735..449781)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T5 "
FT   CDS_pept        complement(449958..451163)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875749"
FT                   /orf_name="An01g01880"
FT                   /product="Catalytic activity:"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43559.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG517781"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000EF9E45"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T6"
FT                   /transl_table=1
FT                   /translation="MPPPPPYTYQSEVYTHGLRDQKPAITFIASEWENLARARLSANSF
FT                   SYVHGSAGTGETDRKNRSAFQSWSVIPSRLVPSAEFPDLSTTLFGKKYASPIAIAPVGV
FT                   QTIFHPEGERAVARAAAGLDVPYTLSTATATSTEDVAEANGADGKRWFQLYWPGNEHND
FT                   ITVSLLERAKKSGYDVLVVTLDTYILGWRPTDMDNGYNPFLRADSIGVEMGFSDPVFRR
FT                   YIRDKFGKEVEEDKGTAAGEWTKIVFPGVSHSWEDLAFLRSHWEGPIVLKGVQSVGDAR
FT                   RAVECGMQGIVVSNHGGRQMDGGVGSLTVLPGIVDAVGEKIEVLFDSGVRCGADVVKAL
FT                   ALGAKMVLVGRPYVYGLAIAGEEGVRHVLRSLLGEVQLSLHLGGIRSVKKEDLNRDCLV
FT                   RE"
FT   CDS_pept        join(452001..452149,452187..452445,452531..452725,
FT                   452848..453300)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875750"
FT                   /orf_name="An01g01890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43560.1"
FT                   /db_xref="UniParc:UPI0000EF9E46"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T7"
FT                   /transl_table=1
FT                   /translation="MKGSQLVPNRPLNSINQIVKQDRLDGPWHSGARWIIRDLAQSFDA
FT                   LERHWSHLSPCPILQPSRLLVNKALTATSTLSLLPSQLRLAGDIHIAAAVQVPSTRVRS
FT                   AAPLGYGAPTRAWWRWCQRQPIEQCDLDSRLPIADPCTVAWACFGQERVRSGHFCHRMR
FT                   LSRQSPMSMTKVPGTLRYIGQYYHAQKAKAVAFRQTSGGVSEISVSAITLITRSSITLK
FT                   HDHTAEYVTTIQFRFTCYTIKTVSLENQPFQSRLGGACDTPHQIIGKSALKVGGAPGIG
FT                   IRVSVVISFKGNPRHGDSWSKQGYLGTVFLAPVTTRFRGQVCREFLAITETIWMEFDTL
FT                   ADFIYCGLVGW"
FT   CDS_pept        join(454927..455345,455410..456020,456077..456323,
FT                   456381..456504,456565..456789)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234466" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875751"
FT                   /orf_name="An01g01900"
FT                   /product="Similarity with several actinomycete antibiotic
FT                   export proteins"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43561.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9E47"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T8"
FT                   /transl_table=1
FT                   /translation="MAILDLLRGRAQEQQPHQFDGDTPSKFPQFTIFSRPGSSLGDDSS
FT                   TPSSGIATPIEEKQLTKLGPCPEIGRLASWKGALILLVTSGSQFLDNVFMTSANVALSS
FT                   IQENFDVSDTNLQWMISAYTLTFGGFLLLAGVLSDRYGRKLILCLGLTWLSIWTLAIGF
FT                   GQSFIQLTVFRGLQGMGAALTVPSAIGIISSYFSGLDRTRALSIYASSGTVGFCVGLIF
FT                   GGFLTSSLGWRYIFYFIVIITGSLGILGAIVLPKDNLGGKEKPKMDYVGAMLSTAGLIL
FT                   LQFVLSSGGSYGWGTPFIIVLLVLAVALLVSFTLWEKFISYPLMPLGLWKLPNFAGLWI
FT                   AGFTCYGSYQNVIYYIVLMAQEVDKLSAGDTALRFLPMGVIGFIASMGTGKALEYINGK
FT                   YTLLAGLILTVLAPVPSAITSSPETSFWVNVLPTSLISITAVSLIFVTTSTAILTTVPV
FT                   HVKSLCGGMLNTAFQIGSGVALAISAAVAEEVDIKKGHDLAHQYRTGLWCSAGLAGLGL
FT                   IIAFFSVSRRGIGPGDRDDTVCAI"
FT   gap             456901..457000
FT                   /estimated_length="unknown"
FT   tRNA            457050..457121
FT                   /gene_name="tRNA-Ala (TGC)"
FT   CDS_pept        join(complement(459883..459937),complement(459362..459834),
FT                   complement(457714..459315))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875752"
FT                   /orf_name="An01g01920"
FT                   /EC_number="3.2.1.52"
FT                   /function="beta-N-acetylhexosaminidase activity "
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK43562.1"
FT                   /db_xref="GO:0004563"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="InterPro:IPR001540"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EF9E48"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T9"
FT                   /transl_table=1
FT                   /translation="MRWRALGTLSLVLDFTICGFARLVTVPTIPFDDNNGTYALSQLTK
FT                   IVVDTRHASTVDTQGQTLIPPTLREFAATFQEDLRSSLGINLPLVSSSTSSDNTIFLTL
FT                   SNNTGFRDVAGRFTAEAYALHIDNKGITISGASPLGVWWGTRSLIQAAVVSKHDLPQGS
FT                   AIDAPGWETRGVMLDAGRHYYPPDFLIEMCSYLSFFKQNVFHLHLSDNLYNNVDLYSTQ
FT                   ESMDLYAAFRPWSDDPAVSGLNKRANESYTRSQFDHIQRQCARRGVTIIPEIEAPGHAL
FT                   AIVQWRPELGLTDLSMLNISHPDTIPTMKSIWKTFLPWFHSKTVHLGADEYSSSYVADY
FT                   TDFVNDMHTYIAEQSDKDTRIWGTFTPSEGANVSKAVTIQHWEYFEDNPYFDYIKNNYS
FT                   VLNSDDAFYIVGKWSGSYPQYLNKTRVFHGDPANNGPYAPNIFSTSNATDNPPRNNPYV
FT                   LGHIAALWNDYGPNATTYLEAYYSWRDVLPALADKQWGGDILEEEYDDVFDALHAVIPG
FT                   QNLDRHVPSKTDLILHYNFANATGTTVPDLSGNNYHATFNHTCPIDTSNSTIRFTGTCT
FT                   LTTPIQSKGRDYTLSFSVYPSTTHPSPLFSGRDSTLLNGNGSISNITLVSGGNPYTLNY
FT                   SLPVGKWSDVSLIGKGNKTFLSVDGGEKMEFLARLGVNGESLVWAPIAIEAPVQRIGEG
FT                   FVGMMGDVKLWGSAK"
FT   mat_peptide     join(complement(459362..459826),complement(457717..459315))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T9 "
FT   sig_peptide     join(complement(459883..459937),complement(459827..459834))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T9 "
FT   CDS_pept        join(complement(461671..462013),complement(461482..461524),
FT                   complement(460754..461222))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875753"
FT                   /orf_name="An01g01930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43563.1"
FT                   /db_xref="UniParc:UPI0000EF9E49"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U0"
FT                   /transl_table=1
FT                   /translation="MSNNLTRKPSISASSLGEVRKIYMSKMTEQGCSRTLKDKCRDIWH
FT                   EVINDAIDAEAECSMRGIAIVHEKKQEPAYIQSKGNGKKDSSEGDTESETETEESNSET
FT                   EVEIDPSLDGILVFVWRWIWMLGVCLNNMSSPSRDFSPEDLDDLANDLKDIQEGLAPSI
FT                   HYFISFQTGALLDHLDEVRDALDLQLINLTEMLDRLKRGLDQVKAIRKAVKAEENETSE
FT                   EEEVKESEQHPHQHHATKSPVAKSPKHRFSPAAKVKVQESDGDADSEREIEAEKEDFET
FT                   LFQ"
FT   CDS_pept        join(complement(465122..465415),complement(465009..465055),
FT                   complement(464905..464958),complement(463791..464838),
FT                   complement(463553..463729))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875754"
FT                   /orf_name="An01g01940"
FT                   /product="Function: UGA4 of S. cerevisiae is a GABA-
FT                   specific high-affinity permease"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43564.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG328455"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EF9E4A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U1"
FT                   /transl_table=1
FT                   /translation="MADIKAPANPAMETDGAELEKVRIAGTNQADTQLAAEFGYKPVFK
FT                   REFGYLSTFSFAVSISGLFATIMTTMSYPLEAGGSSAVVWCWLVSGAGCMCIALSVAEL
FT                   VSAYPTSGGLYFTISRLAPHDWVPSISWVTGWLNFLGQICGVASSEYGGAQMLLAIVSM
FT                   CKGMDNYEIKTTTTVGVMAGLTVITGLVNSLSTYWMEKMTKFYVIFHVCILVACAIALL
FT                   VMTDDKHDASYVFTHVESTTGWKPIGFSWLFGFLSVSWTMTDYDATAHITEEISNPEIK
FT                   APWAISMAMLFTYLAGFLFNIVLCFCMGDPNAILNSKMEQPVAQIFYNSLGKGGAIFFT
FT                   ISALLIIKFVTFTAMQSLGRTVFAFSRDRMLPFSNVWVKVSPITGTPLYAVWISVFFCI
FT                   AINLIALGSYTAVDAVFTLCSIALDWSYCIPVLCKLLFGQFKPGPWHMGIFSTVVNAWA
FT                   CLWTLFVSIIFVLPTDRPVTPDNMNYACVFLVFVLLFALVYWFISGKRFYHGPITEAVV
FT                   ADSASESNLPGDAKSEKDGQEN"
FT   CDS_pept        join(complement(467930..468435),complement(467286..467871))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959666"
FT                   /orf_name="An01g01950"
FT                   /product="Similarity: all yeast homologs are about 400
FT                   aminoacids longer at N-terminus"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43565.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0000EF9E4B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U2"
FT                   /transl_table=1
FT                   /translation="MDAKGLHRFSHFSCRTQQVVTSSTWEGLLIEQSTLSADTKGSERD
FT                   TWWVDICDATEEEVSTVCQALSIHPLTAEDIATREPREKIEAFRNYYLISFQTLLPTDD
FT                   FKSSRSLKPSSSIPGSAGFYILVFKNATVTFSPSGCHHIARVRDRIRRTQDTHLVSSDW
FT                   ICYALIDEIIDDFEPYMRAAEREADAIEDQVFIARVDDVKALIPQLDSLRKSITQLIRC
FT                   LTGKYDVLSGFVKRCQAKDRNPMFPDGDLLVYLGDVQDHLVTTLTSLSHFDEIVGRSQS
FT                   NFLAQLSVNNIRLSYDVNAVLSKVTILATIFVPLHMVTGLFGMNVEVPGQNVDNLGWFF
FT                   GIVGCMCAFVMVCCLLAKRLRLL"
FT   CDS_pept        470513..471340
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110567"
FT                   /orf_name="An01g01960"
FT                   /product="Catalytic activity: catalyzes the reduction of 2 "
FT                   /EC_number="3.5.4.26"
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase activity"
FT                   /function="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="CAK43566.1"
FT                   /db_xref="GO:0008703"
FT                   /db_xref="GO:0008835"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG668075"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="UniParc:UPI0000EF9E4C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U3"
FT                   /transl_table=1
FT                   /translation="MDSLNFPTQDRAFLEPHLPPKYGNPSSSSSLPFTTLTFATSLDSQ
FT                   LALSPGTRTVLSGPQSKAMTHYLRSRHDAILIGVGTAVADNPGLNCRLAGVGGYGSEGL
FT                   AGQPRPIIIDPSARWEFTAHSKIFELARNGRGRAPFIITAAETVPSAPQREVLESHGGK
FT                   FIALPVGVGSDGAHRIDWTALLECLVREGLRSVMIEGGGSIINSLLEPGCQTLVDSVIV
FT                   TIAPTWLGQGGVVVSPRRRVEGGMVVPASRLTGVKWYPFGEDVVLCGRIKGSD"
FT   CDS_pept        join(complement(472301..472604),complement(471917..472243),
FT                   complement(471856..471860))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806417"
FT                   /orf_name="An01g01970"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An04g02750 - Aspergillus niger"
FT                   /protein_id="CAK43567.1"
FT                   /db_xref="UniParc:UPI0000EF9E4D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U4"
FT                   /transl_table=1
FT                   /translation="MGNKVSNISSIPEEFLADDWEEHYARARNPFCGYNYCCCYICGFQ
FT                   YNDSWGMRPVSYRVRGDKSYPRHPNYKAVAQAEGIEEERLRHIEYVPNRWWMWQRMIIH
FT                   REAKSTYRVSGTYLLEQETWRLCVPIMVKGKRVYVDPKVYCMGMKATSPADWVGCTVHA
FT                   RCWELLSHHALGRVAETDLPAVIAALRYRRRVVGSPCKRWEHKMFAED"
FT   CDS_pept        join(473738..474681,474712..475185,475221..475353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876755"
FT                   /orf_name="An01g01980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43568.1"
FT                   /db_xref="UniParc:UPI0000EF9E4E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U5"
FT                   /transl_table=1
FT                   /translation="MPDFQDVEDVWHEICEYLETRDLFNICLTSRTINHVGTRYLYRKI
FT                   KWDWKGKKSRYRIMSLWTALVQDKDKRSRLCGSVREVHLLGSTPPKDTRIVECPEIQEG
FT                   NPSSLSIIRSDKVPFYQEIDYLRDVVSSVVESPKGRLAWLESIAARNVYALVALLLPLL
FT                   HNLRSLKLDYTFAVNGGYPGQMIESLTSGKEIHSAELQNNFEHLEVFDYGTNALHNNLP
FT                   HSCDNTHIRMRYSSQLIPIFQLQQVKHLKVWLRSRHGLLLARIPDVQMNHWALETLVLD
FT                   HISVMDCALFKVFKRTNKLRSLHLGMNAEEKDFCKYIWNGLRALCGCLEHLSISFSITP
FT                   RSREYRIDTIMWGPLFRHMTAGFFQDFTRLKTLELPIQMLNGFRDIMEVGIQQDLPVTL
FT                   EKLGLRWDFRDVESYDVPTATVRILWVLTEFLRLPDRHQRVPLLQEVIIRLFIGEDGLS
FT                   RTVVDCDDLIEQFNMTVDERTLMLNDVSLDIRGIMPNHRRQSYPSSTHYSLLLPDRQT"
FT   CDS_pept        join(476179..476245,476295..476470)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806671"
FT                   /orf_name="An01g01990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43569.1"
FT                   /db_xref="UniParc:UPI0000EF9E4F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U6"
FT                   /transl_table=1
FT                   /translation="MCFTSYSDEPVSPARPRPTSTNEQEGDEADDTMEEAMFLAQLVAE
FT                   GEVGQAVVVVEEEEEEEEAAEEEEMMVEGEAEDEF"
FT   CDS_pept        join(477442..477490,477600..478530,478587..478881,
FT                   478963..479157)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000121941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959922"
FT                   /orf_name="An01g02000"
FT                   /product="Catalytic activity: L-Tryptophan  "
FT                   /EC_number="4.1.1.28"
FT                   /function="aromatic-L-amino-acid decarboxylase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAK43570.1"
FT                   /db_xref="GO:0004058"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG708517"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniParc:UPI0000EF9E50"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U7"
FT                   /transl_table=1
FT                   /translation="MDREQFREAAHSAIDDIINYFDDLPNQRVVPTIEPGYLRPLIPTS
FT                   PPENPEPWSAIQSDIETKIKPGITHWQSPNFMAFFPAGVTYPSILGEMYSAAFTAPAFN
FT                   WLCSPACTELETIVMDWLAQALALPECFLSTSENRGGGVIQVTASDTVATMMIAARERR
FT                   VTEMVVSEGFKPDTVEYEDRMMELRSRLVALASNQAHSSTAKGALLAGTRFRSVEARLE
FT                   DNLEMTGERLRTVLEGLDRDKLTPYFITLGLGTTNSCAVDRFREIKAVLAEKEHWKRIW
FT                   VHIDAAYAGAALVADEWQYISKEFAEGVDSFNMNMHKWLLVNFDASCLFIRNREDLTNA
FT                   LDITPAYLRNHYSDSGKVTDYRNWSMSLGRRFRALKIWFVMRSYGLTGMKDYIRKSIGL
FT                   GETFAGLVRGRADLFDIITTPAFGLTAANELTKEVYELVNSRGEIFITSTVVCGVYAIR
FT                   VVSTNPAAEEKYVKRAFEILVETAEEIIKRG"
FT   CDS_pept        479790..480995
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959923"
FT                   /orf_name="An01g02010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43571.1"
FT                   /db_xref="UniParc:UPI0000EF9E51"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U8"
FT                   /transl_table=1
FT                   /translation="MDKPTGVASSQMDKPRLGGKMNLPAGGATTAPVRDVSNKKKRALE
FT                   EDSDSENIDDGKRTCIHLIDEAMKDLELGFEKDSEDDYESDSKTESDSDGGSSNDEDRG
FT                   NSSTEETTVIDEDSSNDEDGGDSSTEETTVSDEDSSNDEGSDLGGRDVTMDEIMDFNSE
FT                   ESTSDETMDTSDEDSSRDEASDWSVGSGSSDEEEYMDVSDAESWSSEHWNDSDQSDDED
FT                   YTFERPEAWKWSKDNNINNNKDGDEEDGDRLMIQLTYPNHTHKICDDTSSEDEDGDALI
FT                   QEEVDDASSEDEVETEDENKSGCADGDSSTAFPACEFLDKHADKPGYIYDMTSHGKNIL
FT                   ILITTSSPPTLIRASTRDLIMGSSVFAKVFGYNEEIRVSGKIFSSWRKIQKVTGCHRAE
FT                   FI"
FT   CDS_pept        join(481538..481618,481671..481776,481868..481948,
FT                   482007..482041)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876756"
FT                   /orf_name="An01g02020"
FT                   /product="Similarity to hypothetical protein ssl3291 -
FT                   Synechocystis sp"
FT                   /protein_id="CAK43572.1"
FT                   /db_xref="HOGENOM:HBG540835"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="UniParc:UPI0000EF9E52"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U9"
FT                   /transl_table=1
FT                   /translation="MPLARATFEDIILAESPTWETVEGNIYFPPTAIKDKSLFVPIDKV
FT                   TFCPWKGDASYYSIVVGPTTIPGGAWYYPNPYDAASNIKDHVAFYTTGSIKVSVE"
FT   CDS_pept        join(complement(485938..486460),complement(485793..485888),
FT                   complement(484769..485640),complement(484393..484674),
FT                   complement(484249..484323),complement(483830..484170),
FT                   complement(483616..483721),complement(482341..483612))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876757"
FT                   /orf_name="An01g02030"
FT                   /product="Function: FUM5 of G. fujikuroi is a PKS gene
FT                   required for fumonisin biosynthesis "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43573.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniParc:UPI0000EF9E63"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V0"
FT                   /transl_table=1
FT                   /translation="MVEDSGPSRQESICKIISAYVENDKNDDRSILFECVGKIKANCER
FT                   IVLGEVSSLDVLEVEGRLDRYNKWIQSQCNWSRFLSLLDHSNPTTRVLKIGSCTGSATE
FT                   AVLRYLRSPEGVPQCSQYTVTEECEATLTALQQKFQNQEGLQYALLDISGDLEAQGCNL
FT                   QSYDLIIASNVVAHGTARIATAVEHIRQLLAPNGRLLLHEIYPEGALSNWSSVEDFRAY
FT                   SIPYLSPDRWDIELRNAGFIGSEVMAYDVPHPHQTYFTMLSRVPHPPPEAETYDTVTIL
FT                   TTDSPGSWASEVASRFRQGGHVVNWTTLHDTPPKDQWIISLLDLDGPYLNNLSEERYLA
FT                   LQSSLMTADNSHLIWVTNTSQMACADPRYGLIFGLTRTLRHETATGISLFETDSYTQPA
FT                   AGALFQVFNKLQRTRQCPDARPADSEFSFEGVIHVGRCHWIHPKQITPRPETPCPRKLD
FT                   VSPVGLIDTAHWVPVDGHQGELETGQVEVDVHYVGLNFRDVLVGMGVFGSADELGLEGT
FT                   GVVRRVASDVKDLQAGDHVVMLAWRLFRTRVVLSATACRKLPANTPMDDAATVGSVYMT
FT                   AIFCLCHLARLQNGNSVLIHSACGGLSLAAIQVCKVMGAKIFATVGSDEKVEYLVKTFG
FT                   IPRSHIFSSRNTDFLPGLMAETQARGADIVLNSLSGKLLHTSWECVAPYGRFIEVGKRD
FT                   YLANGQLAMAPFIQNRSYIGFDLFQMGKEKPRDYDLLLQLFREWYEGGHIKPLRPVKIF
FT                   EAAKVTDAFRYMQGSHMGKILIRMPSDPMELAPTSVPPVSFSPNKSYLLVGGLGGVGRS
FT                   VCLWMMQRGARHLVILSRSAGKSNADRDFILDLEEQGCQVICVAGIVAAAADVQSAISK
FT                   CPQPLAGILQMSAISRDQRFANTTYDDWTTCLATKVQGTWNLHHAASDQPLDFFIVFSS
FT                   IAGICGNHGQASYAAANTFLDSFTRYRRHLGLPSATLALGPVEDCGLVSRNTKLLQAMQ
FT                   ATSVRLVGEDELLEGLELAIHQSHSPSPSALTTSHIKSISQSSTSDACIIGLGNTRSTN
FT                   DPSVRAVWTPSDPRFSLYTNIETKEQSTTVGGTALKEILRRVEQDPAMLNNSDAANNLS
FT                   HELSKHLARHMPGAAEMSAEEAAEMPIDSLMAVEIRRGLRGDLSWDISMVEVTKIGKIG
FT                   RLAEAAIQHLKKKYGLVKESEQ"
FT   CDS_pept        join(487264..487440,487519..487795,487845..488263,
FT                   488317..488964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876758"
FT                   /orf_name="An01g02040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43574.1"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI0000EF9E64"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V1"
FT                   /transl_table=1
FT                   /translation="MAKPTSDIELSPADLGLPRFVEAHLAIVVRAKPEPHDCQRAAQEL
FT                   LATYPMLAMRMDFWRTKLLHSDYPAEIYHSRTLKKDLDEVLPCQTAKVGPPAVQLLDTC
FT                   SLLDCLNFNRDIWDEICGEQVLRIRVVFLNDAWAVRFIMSHTLGDIRVPVGLNSLLSNS
FT                   MCHTAMHWIADSFFAFLSGREVQTVSPIRSILTFKSDIIDSWNALTASGTTHSVAEDHQ
FT                   HEIVAGWLPTILSGARQILWYAYEASSPRRQVNKSLFIPQCIIDHWVQGARREGIQVTE
FT                   HDLLMGFIYEATYRALSAPPHFTFLMNFHQQLHSPGPLGNTWFQIPIPALHKSKSSPST
FT                   PFPKDHSSTLLPMLLHHAQLIRDIIVKCRHPACFPEIYEQHRRLGTTPWRPRSFGTRSP
FT                   HVMVSCWTKQQWYELDCTGGTPLFVDLGACFYRLFQLLGVQGPDDFVGTIKCPGGRNST
FT                   LMGEHKGYWVQGRLPEVTWATMVDMLTAVSFGDGGGQKQGLGQTFANI"
FT   CDS_pept        join(complement(490623..491550),complement(490479..490527),
FT                   complement(489382..490429))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110815"
FT                   /orf_name="An01g02050"
FT                   /product="Remark: At221 might be involved in the gene
FT                   expression regulation of lovF"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43575.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9E65"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V2"
FT                   /transl_table=1
FT                   /translation="MKRKAAFQLPHTPRRAPRQDPVSCDSCRLKKIKCDRQQPCSSCSA
FT                   RRLTCRYGKPEAAGTARVQKPLLAAGVERTSPPSNPTVPPRADNVPIEPTAAPLRACNR
FT                   ESLLTADWLENIHMADRVPTATPKWLRDGLDDPVRGRNLNLSLNDETGSARPLLSMPYM
FT                   NRSAIDENPASINLITFVPAKSEALDLFRYYHRYVDYLYHIIVPKRVEGQINGIYRCIE
FT                   SNAPVDLNHLALLFGILASSLCLQRSVVASTDAEARSQEFAFLTGAALIQSHYSLSPTL
FT                   VGLQATMVVMHNVSNWNIPPSVSGLFVHDLEVKRRLWWDLTSFDWLLGFLTGPQEWTYL
FT                   IQPHHMNVNQPLNIDDNAMCHNMVSMPNSTPTDMSFFLQRLTLAAVSREVVDATSYEHL
FT                   HGLEPIYEKILELDKKFHRAVAEIPDFFRLDPSSRRRFASLYEERPTIAWQGCLLQQGF
FT                   FSRLCRLHRDFFIRGAREPAYSYSHVICLQSARKVLEIKRIMDGNEPNYTPPNSVVWSV
FT                   MHHVFAAAVILLLDVCFNWDDILAEKRKEEVLDACRMLSKAQESSALVREGINAMMGVL
FT                   QKHWRTGKQAENHTITSQGADGARSHPGSAPAHVPALNAESNVMPPHLPAATNDNAPHE
FT                   RQLEDIWTEMLETGNDLALDSADWTELLNELTDPELSRG"
FT   CDS_pept        join(492021..492070,492118..492334,492396..493172,
FT                   493238..493351,493436..493540,493719..493748)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876759"
FT                   /orf_name="An01g02060"
FT                   /product="Similarity: similarity to YOR306c "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43576.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329790"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9E66"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V3"
FT                   /transl_table=1
FT                   /translation="MAHAEDAPTDSPPSEYTPRAVQTLLGSFCGMFCTVGFVNSFGLFL
FT                   EYYKKDQLSDQPESTIAWIAAIDIFFIFGVSVVSGPLLDTIGPRLLLCIGSLGSVFSIM
FT                   MTSLCKELYQFILAQGILLGISLSLLTCPMIALVGQHIKIKRGAAVGIVIGGSSLGGVL
FT                   WPIIVNELLQKPNIGFGWTMRIVGFIMLPLLTVTCFCCQPAAPPPSPSPSQYQPEPQSE
FT                   KSSPEPQSPDPTKDTETPLLQNRTLHLTCLSFFIIYFGMFSPFFYVSSYGVARGFSSSL
FT                   SFYTISMLNGASLFGRVIPGILADKYGRFNVCIVFTILAGIVALCWTKATSVAGLVVFS
FT                   IAYGFSSGCGSGIGYSLSPASVRVAVGDAEDGGVGGGGCYGGYGFECYGWDTYFRGAGA
FT                   EVWVSGAVDIRGGESARGWVVVICRYCISAR"
FT   CDS_pept        join(complement(495560..495910),complement(495125..495513),
FT                   complement(494532..495082),complement(494072..494486),
FT                   complement(493813..494002))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959924"
FT                   /orf_name="An01g02070"
FT                   /product="Function: A. fumigatus secretes a serine alkaline
FT                   protease"
FT                   /EC_number="3.4.24.-"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK43577.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG736298"
FT                   /db_xref="InterPro:IPR001842"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="UniParc:UPI000004F5FA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V4"
FT                   /transl_table=1
FT                   /translation="MHGLRLVCSIGTLPLVILAYPAASLHTTSAAVDLDSLRLTSNSEY
FT                   VNSVHVDTNRSVAVSAEEHYTDTAARLVQNIVPGASFRLIDDHFVGDNGVAHVYFRQTL
FT                   HGIDIDNADFNVNIGKDGLVLSFGHSFFTGALPSSHLDNTNVLSPEAALRGARDAIQLP
FT                   LTIDNVSTEAAEGRNEYIFREAVGAVSDPKAKLVYLVKPEGTLALTWRIETDMYEHWLL
FT                   TYIDAETTTVHGVVDYVADATYQVYPWGTNDPAEGHRTIVTDPWDLSASAYTWISDGRD
FT                   NYTTTRGNNAIAHWNPTGGGSYLYNLRPSDPNLNFQWPYSPNMSPPRSYINASIVQLFY
FT                   TANAYHDLLYTLGFTESAGNFQWNNSAHGGRDKDYVILNAQDGSGFSNANFATPPDGIP
FT                   GRMRMYIWIESTPSRDGSFDAGIVIHEYTHGVSNRLTGGSHNAGCLSALESGGMGEGWG
FT                   DFMATAIRIKPNDTRTTSYTMGAWADNDKCGVRDYPYSTSFTENPLNYTSVNTMNGVHA
FT                   IGTVWATMLYEVLWNLIDKYGKNDGSRPVFRNGVPTDGKYLMMKLVVDGMALQPCNPNF
FT                   VQARDAILDADIVLTGGKNRCEIWRGFAKRGLGQGAAHSSLNWMRRGSTLLPTGC"
FT   mat_peptide     join(complement(495560..495820),complement(495125..495513),
FT                   complement(494532..495082),complement(494072..494486),
FT                   complement(493816..494002))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V4 "
FT   sig_peptide     complement(495821..495910)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V4 "
FT   CDS_pept        join(complement(496831..497234),complement(496672..496771),
FT                   complement(496556..496594))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876760"
FT                   /orf_name="An01g02080"
FT                   /product="Similarity to hypothetical protein SC2G5.30 -
FT                   Streptomyces coelicolor"
FT                   /protein_id="CAK43578.1"
FT                   /db_xref="HOGENOM:HBG325003"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="UniParc:UPI0000EF9E67"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V5"
FT                   /transl_table=1
FT                   /translation="MSSDLPSPSSITSLPQEQQFRVLDTLFESSPELHTLMAPVLANQT
FT                   FSSYATLIDAVGGRMSALSAANSSKDRDILVGILGSHPRLGQPKGAPTEHLSELSKKEQ
FT                   ANLNTGAEEQAEKLKRMNAEYEQKFPGLRFVTFVNGRNRDVIMEEMRERIDRGNADREV
FT                   EEIIQDRARKLEQSAKI"
FT   CDS_pept        join(499043..499116,499239..499426,499537..502572,
FT                   502624..502667)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176423" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110816"
FT                   /orf_name="An01g02090"
FT                   /product="Similarity to hypothetical protein BX908807_12 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43579.1"
FT                   /db_xref="HOGENOM:HBG329791"
FT                   /db_xref="UniParc:UPI0000EF9E68"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V6"
FT                   /transl_table=1
FT                   /translation="MSLNGLDNPTVIDAYQTALTEAGGWFLLRYVSRDEVALLDRGTGG
FT                   VPDVRNAIDGYEEKSPLYGFLQYRRRKVVLSYLPEGMSRLVQDKFSPHDTVFSVTQPSE
FT                   LTESALSSACLLHTASGSITSSSSSLRRRRLKEIAEDAEETTVGKDENQAQSAADGMPR
FT                   QRSFSQLSEATVVPPSVVSSVQQSPVGNEPTPKTSENASIRERSSSVATSERAPSYKNF
FT                   REDSSYAPSEPRQSSQSARPSVRDLERAGYKAKVKLGPRPSVDGSGRPRTAGNLSRSAE
FT                   RRPVASLPAGVRSSSLRKSNPSPSRPRSSGGHGTPVASRVPAVPPLLVPPFSMPISRPK
FT                   ISPGAKSLSALSSSTTSNEKERLMKALQMRKTQMEKKAKEGKNSSTTEKGEVSGLDMTE
FT                   NKENIGHIPSKMKHDGGDDRMAHLAGPNKEPLSETQPTLQPMLRHQGAEEEDGRTTPNS
FT                   PEPSGSHHSLSQPARLSNSSNEFQATTPTRSGSETQAGDRDLGASNSGGVSGGPSSPTR
FT                   LPSAIAAPLENNSGKAPDEEIVGPSPPKPVPHPVVPGEQEALLHHHHHHHPSTPDVTES
FT                   DLFESPARPDSSHHPSAATFTPNSLSIAAPPPTEPQHDLTPESSNVERQRSTSRKEKRK
FT                   PYLEPIQVPTPDYSDDENLLSDDSFMEELTSATVEEAKPISVGVSPLSPGYSNSSNGNV
FT                   SPDAWRNSRAVSNPSAIGHQSPNMSTIAVGRSVSTTGADSGSQNGPVLVARKINVSSGI
FT                   SSRIKALEKFSNSRDAPSMNGQTLAAPSAASFETLRKGYSGPSMPRPLSYAPESFSRSS
FT                   SVRRPSSQAGPGLAGPGLSRSPSSVSVTARIVRDPTAAETNPNADPSEPAVLNLQPSQI
FT                   TVEQETTELPVLTLQTEPTITQSEDDTLPPSSAGSDQQSSVSVQRPESRISTPTSIKEE
FT                   EEVASPAKSSGDAPSSPDEKKESRATRLLRRMSSITSRKSVVGVLNPIKGDDHVVPIKL
FT                   EEPERPVSRATEVAPAIDIGEVNVQFPDTLLWKRRFVRIDDQGYLILTPGNLDSTNRNL
FT                   VKRYHLSEFRTPCLPDEDRQELPNSILLDFLDGNTLQCACESRQGQTFVLQTLRDAHST
FT                   YQTVSH"
FT   CDS_pept        join(complement(504413..504446),complement(503174..504345))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176412" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806672"
FT                   /orf_name="An01g02100"
FT                   /EC_number="5.4.99.-"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="CAK43580.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG397258"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0000EF9E69"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V7"
FT                   /transl_table=1
FT                   /translation="MSGEKIYEGVFAVHKPQGVSSADVVRTLQTHFNPSTLFAPWLADE
FT                   RARRARESTYQRKRRRTQRLDVKIGHGGTLDPLATGILVAGVGKGTKHLNEFLGCTKQY
FT                   ETVVLFGAETDTYDRLGKVVRKAPYEHVTREMVEKALEQFRGKIMQRPPIFSALKVNGK
FT                   KLYEYAREGKEPPIEIQKRPVEVTDLRIVEWYEPGTHEFKWPEVEAEGEEKAVAEKLLA
FT                   KEDELPIVEREADGEGEASAKRKSPPAEDAKEEKVEGGDAESAPSAKKQKVADGEAAPV
FT                   APAEQEASDAPKAEAEESSESKPQSQPQPAAVKITMTVSSGFYVRSLAHDLGKAVGSCG
FT                   LMSSLIRSRQAQFELHPDKVLEYKDLEAGEEVWGPKVQRFLEDWEEKRLARPSSPRSPK
FT                   QN"
FT   CDS_pept        join(505103..505307,505394..505662,505738..505896,
FT                   505952..507046,507131..507160,507211..507246)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176401" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876761"
FT                   /orf_name="An01g02110"
FT                   /product="Similarity to hypothetical protein CAD11409.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43581.1"
FT                   /db_xref="HOGENOM:HBG325004"
FT                   /db_xref="UniParc:UPI0000EF9E6A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V8"
FT                   /transl_table=1
FT                   /translation="MTSREDSVLAARDPSLTDENDWEEFSLSEVRVLVPGKSRYANLLT
FT                   ASPENPVQVTGCLDEVEEEQEKLVLDPEYLTKRIVLENVTHFAYGQHNDGEVGFWVAGK
FT                   AGWFSISPAKGYKAIFNDVVEAIDLLYFLADRHQSKRRRKRRNWNPSVEYLCEEYVSHT
FT                   HGICEDADDSAEVFYKHHHFLLSRMLKGEEDVQWTNTCIFEHLCEKFPDDFKQIKAQYE
FT                   GAKEVESEEEEEDEQEEDKEMDEKEGQDEAEARPDTSGLSKDQADAIYKVILDLKEAGY
FT                   LAKRQLTFELLINTLVERFAIDSTDYAHDLVAARADAIIEMMDEVKTYNFDWSRKVIYR
FT                   ELKAAAKKNRVQQITLTPLRPRPSDDDESSGEESEHEDHPRLRRRRVHKSVLRPKSSVA
FT                   TKQTGKRTRSAVDDQDDDSDNNEDAMDEFETPSKVRGHDLVRDPLSTRAKRRTRSLLYD
FT                   STPIQKTPLQETLQSRNTSVSGADRETNADASELEATFEDDVTSDTWTCHVRGCEKVIH
FT                   KSNSKRGKELIQDHALAHADDTKAKIDLVFAEQRLNIGLPVDNLLSRIREMGAFDTDHP
FT                   TDDVRVQSATVRSSQHITESG"
FT   CDS_pept        join(complement(507875..508658),complement(507483..507793))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876762"
FT                   /orf_name="An01g02120"
FT                   /protein_id="CAK43582.1"
FT                   /db_xref="HOGENOM:HBG714721"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniParc:UPI0000EF9E6B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V9"
FT                   /transl_table=1
FT                   /translation="MPKRSKLLQALDEHRGRDYEAEKQKKLVKAAKKKTTATKGEDVKE
FT                   AVVEDKKEEKKKEEEVEEESEDEETPEETPSDAEEEEEEDDEEEAEESDIPLSDLSDDE
FT                   REDVVTHQRLTINNSAAITSSLKRISFLTPATPFSEHNSLVSQEPIEVPDANDDLNREL
FT                   AFYKVCQAAAMTARSTLKKEGVPFTRPGDYFAEMVKTDEHMGKIKKKLYDEAAAKKAAA
FT                   EARKQRDLKKFGKQVQVAKLQQRAKEKRETLEKINALKKKRKAETGGPTDDSSNMFDVA
FT                   IDDAAQAGGRKRGRDAEGGPSMKRQKKNEKFGFGGKKRFAKSGDAVSSGDMRDFSVKKM
FT                   KGGPKGGGAKRPGKSRRAAAKGRS"
FT   CDS_pept        509974..511188
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876763"
FT                   /orf_name="An01g02130"
FT                   /protein_id="CAK43583.1"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniParc:UPI0000EF9E6C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W0"
FT                   /transl_table=1
FT                   /translation="MPLSYDKLDPSASQIRLLTIIPDENDENPVCGSLHTVSLNDTCDF
FT                   DALSYVWGDTSVTVDISVDNCIVGVTPNLHAFLRKIRQPNTERTVWVDYVCINQNNISE
FT                   RNSQVALMCQIYSNARSVVAWLGDLAPEALELIEWYHANRNGFYFESTGLHIDKAIEKL
FT                   LTPAKALCSSPYWHRVWTFQEWHLSKIAPVCMHEKTTFTMGNIFNRLHDEVAVARSRLT
FT                   SDTISLDMPYRAYPKPVVANSRCALFFGLQRRLDTLVNYIPRDILHLNPYTPRPSGLGD
FT                   LLSLTRDRQCSNELDKVYALYGLSPVARVTYPPDYRKTIGQVNHETTSFILGHEANMNI
FT                   FNDFDFCFNSANKDESLPSWVVDFTTTDPKHREKMQQSFSKTMNLDKALWEQSRDHAPI
FT                   VADDM"
FT   CDS_pept        join(complement(515221..515462),complement(514962..515133),
FT                   complement(514636..514887),complement(514068..514587),
FT                   complement(513981..514017),complement(513646..513913))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157494" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654005"
FT                   /orf_name="An01g02140"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43584.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328832"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9E7B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W1"
FT                   /transl_table=1
FT                   /translation="MKEESPVPAAMEAEKSSGAASHVEDAEKNSIHPGESLDYFTPKEK
FT                   KRLMRRIDIRLVIPLGCLYCISLLDRTNLGAASVAGMQEELKMNAKNNGYSISSLVFFI
FT                   TYTVFQPPMTVIIRKLGPRLFLSAIVLLWGVVMIGFGMSPTWPVLAGLRVILGALEAGF
FT                   YPGCVYLLSTWYPRFELQKRNALFYLIGSTASGFGGILAYGLMQMHGIGGKSGWRWIFI
FT                   TPQIEGILTCVMGIGSYAILVDFPEQSPKSWHFLNESEAAYVVATIENDRSDVYTEPFT
FT                   LKGYLRSGADSKVWAYAAMYMLTTANSYSIAYFLPIILEDSMGFSVAKAQCLVAPPYVA
FT                   AAIVMYTQAVYADKWHLRGPIIAANAAMGLVGLALLGYLSESGPRYFGVFLATIAANAN
FT                   CPALVSWQSNNVRGQWKRAFTSATLIGGGSIGGIIGTTVFRAQDAPNYRPGLLTTMIAN
FT                   ALVIVVVAGLSFKFWRANRRVDRGGKPIEGLAGFKYTY"
FT   CDS_pept        join(complement(518111..518691),complement(517870..517999),
FT                   complement(517120..517820),complement(516907..517071),
FT                   complement(516465..516855))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175529" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876764"
FT                   /orf_name="An01g02150"
FT                   /product="Function: arcA of A. nidulans is "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43585.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329795"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9E7C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W2"
FT                   /transl_table=1
FT                   /translation="MASALGDHVSVPSDLDLSLDLTASGQITDILEFDLDENNLAVTTE
FT                   AITQDTSPSDEGGVSTPNSTSLDAPRPSAAKRKSKIVLAKPRRVRTGCLTCRERHLKCD
FT                   EALHRCQNCRKSGRVCRRGIRLNFIDIQKSTPPHCVVRIPATGVTFRDESRLIASEYVG
FT                   GFERYPPEVAEPSLEKGNATGPCLTPSLSASSTKEGHINATNHTCLNNPEEVYLLQVFV
FT                   EEVGLWMDSMDAVKHFTHILPFHALEEPMLLKALLACGARHLFHVDASYGEEKAAELHN
FT                   VASQYLLRSLQDPDRDSALCATTAILLNIYELMSGRPIQGMSHIAGARALIKECHWNAK
FT                   TPGLGGACFWLNVSMELLSCLHFNWTLSWDPDTWGVELDLNHAQPSVAGNEEAWTHQMV
FT                   FICAKIANFRSLAQPPALEAASDMRISQRYQEWCTYNEWCDQWARAVPRSMMPLGYIHS
FT                   WQTNSKSVFPQIWLIKRSTIIARLLYHTARILLTKTNPVESEYSAEMQTVQQSHARDIC
FT                   GIVAHSRDRGVASLSIRFLAIAAECLATREAQQEALGILEDIIKQTGWKAEHVKQELQE
FT                   AWGWSDSHGPPMHMSEDILALFNSDHPLAADHAPARPKVPAGVINPLMATADFSMENHP
FT                   YQDYYVAPHRSLSHYPFGGF"
FT   CDS_pept        complement(519563..521134)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175540" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876765"
FT                   /orf_name="An01g02160"
FT                   /product="Function: fnx1 of S. pombe required for entry
FT                   into the quiescent G0 state"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK43586.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329796"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9E7D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W3"
FT                   /transl_table=1
FT                   /translation="MRFWLIFSGILMGYVIGFFDSTLMASSHPVITSYFHASNSASWLS
FT                   TAFLLTSTAFLPLFGRISDTFGRKPVYLFAIAIFFVTTAWCAAAQSMFSFIAARAFCGL
FT                   GAGGVFSMGMILSSDLVRLEYRGVYQSYINLCLGIGGCLGLAFGGFLCDQVGWRGAFLV
FT                   QLPFIFVYFIVAAWTTPADLGLKRAKTERKSLTQLLKSIDLVGSLILVVGVTSLIMGLN
FT                   LGGNVLSWSHPIVITSLISSLILAVVFVRYERTVERGVMPISLLVQEPRASLIFGNFFG
FT                   AISVNTMVFNAPLYFQAVKLATPTDSGLRLIGSTLAVTISSVSTGFIITWTKRLKPTII
FT                   FGDIFLLLGGCAAASMSVGTPDWLAMVCVSLSSLGQGCSFPSLMVSVLATTDQEDQAVA
FT                   TTTLGLWRNLGSVMGVATSSWIFQNTLVYQLEEMVTGPNKEGVILLVRKSVQAIAKLDS
FT                   MHQQQGKSRLYVPVEVNDTKSLTSNRSVCCCPSRYFLLCCHLGCSYAPSAPSSPSPQIG
FT                   NQSMRT"
FT   mat_peptide     complement(519566..521083)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W3 "
FT   sig_peptide     complement(521084..521134)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W3 "
FT   CDS_pept        join(523220..523457,523561..523787,523875..524159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000238441" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959925"
FT                   /orf_name="An01g02170"
FT                   /product="Similarity: similarity to S. pombe hypothetical
FT                   protein SPAC13C5. 04"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK43587.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG593654"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000EF9E7E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W4"
FT                   /transl_table=1
FT                   /translation="MPPLRIAILECDTPVEKVNNKYGGYRGVFSLLLRESAAALGQPDK
FT                   LDPETGLEFSGWDVVTAQEYPNLEDVDAIVLSGSKHDSFEDHPWILKLVEFTKKAFEDK
FT                   RVKIFAICFGHQILARALGARVGRNTAGWELAVCEVDLTETGKELFGRDKLRIHQMHQD
FT                   IAYGYPSEVISLGASPRCAVQGMYVPGKLISVQGHPEFREDIMTEILTLRTAAGIFSKE
FT                   QSEDAFNRAGIPHDGIAITMAFLKLLI"
FT   CDS_pept        join(complement(524548..525203),complement(524349..524385))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110817"
FT                   /orf_name="An01g02180"
FT                   /product="Similarity to hypothetical protein YOL032w -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAK43588.1"
FT                   /db_xref="HOGENOM:HBG737086"
FT                   /db_xref="InterPro:IPR008493"
FT                   /db_xref="UniParc:UPI0000EF9E7F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W5"
FT                   /transl_table=1
FT                   /translation="MFSVIIPDHPCLTDIVAVETQPNGQTTKFAFNFPLPPKLTELVVF
FT                   FLPGTVLPPDTAAAIYIQFPDPNNAPQFKFIGALANERPSAILKVQAPQIPGLQNGNAM
FT                   AGAAPMVTLGISLEPVQAVAPQIAALEAEQAGGAGSSLELVRHTRQQKEITTKVLAQRI
FT                   IGNAFNFLASFASEDPSNRGQETVPLKTFRDWWTKFERKVEMDPTFLEREDPSATGSLY
FT                   THRLWSSG"
FT   CDS_pept        join(525648..525688,525754..526681)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110818"
FT                   /orf_name="An01g02190"
FT                   /product="Catalytic activity: ATP + Thiamine  "
FT                   /EC_number="2.7.6.2"
FT                   /function="hydrolase activity"
FT                   /function="thiamine diphosphokinase activity"
FT                   /protein_id="CAK43589.1"
FT                   /db_xref="GO:0004788"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG738523"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI0000EF9E80"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W6"
FT                   /transl_table=1
FT                   /translation="MGKSNLELVIECDRFPYYQDGPASYIEHLKNYHVFKVAGCDAILG
FT                   YILNSTVERFDLPSEWWATDSDNRSVTLLAPADATPQQRSEIMAKTLSKAVELGTFDIL
FT                   KGWRNEMYPIYGPGGKFLLEMERSATPLFGVVSYGVHSTVYVEDENGLRIWVPRRSKTK
FT                   QTYPGMLDNSVAGGMSTTEHPFECLVREAMEEASLPEDVVRANATPAGCVTYTYVRSAK
FT                   AGGETDLVQPEVEYIFDVKVGADIIPKPCDTEVEEFNLFTIEETKKALANGEFKPNCAV
FT                   VLIDFFIRHGILTPENEPDYLEIIARMHRRLEFPTASHVTV"
FT   CDS_pept        join(complement(527094..527422),complement(526894..526999))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806673"
FT                   /orf_name="An01g02200"
FT                   /product="Catalytic activity: nucleoside triphosphate +
FT                   RNA(n) "
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="CAK43590.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG595341"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0000EF9E81"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W7"
FT                   /transl_table=1
FT                   /translation="MSDPVLFEDTFTITTINSQKYDRVSRLSCNSTDTLSHFTLDVNSE
FT                   LYPCVVGESVNMALASTLSLDGKDDSGSKGWREVGMGEQTLANDYDYVCHGKVYRFEEG
FT                   SSQGNMAVFISFGGLLLYLEGPYKKLAPLRIDYVYLLLKK"
FT   CDS_pept        join(527707..528178,528248..528957)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175573" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876766"
FT                   /orf_name="An01g02210"
FT                   /product="Similarity to hypothetical protein SPCC11E10.06c
FT                   - Schizosaccharomyces pombe"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="Elongator holoenzyme complex "
FT                   /protein_id="CAK43591.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0033588"
FT                   /db_xref="HOGENOM:HBG329797"
FT                   /db_xref="InterPro:IPR008728"
FT                   /db_xref="UniParc:UPI0000EF9E82"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W8"
FT                   /transl_table=1
FT                   /translation="MSFRKRNIGLSAGADRTGAVNANAQPQQPSATPELTPGVRPSPDD
FT                   GRPTTSTGTPSLDNLLAGHGGLPIGKTLLIEENGTTDFAGALLRYYAAEGVVQDQKIHI
FT                   VGMPEQWGRSLPGLLGPADAIDDKQDKRKGERMKIAWRYERLGEFGAGIAGSRAPSGDQ
FT                   SQSAADPNVDKRPAFCHAFDLTKRLTHPSIANLNYIPLAPSNEPLFVSIHKRLQAAIAS
FT                   CPPNTVHRILIPSLLNPTIYPPDSCQPDNLLPFLHSLRALMSAQGARVTAMITLPLSLF
FT                   PRATGLVRWMELLSDGVIELCPFPHSSDALATSGAATSQEEPPQGMLKVHRLPVLHERG
FT                   GGSDQNIGQDWAFTLSRKKFEIKPFSLPPAEGDKEGQDAAVTGGMPKKADLEF"
FT   CDS_pept        join(529861..530368,530491..530814)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654006"
FT                   /orf_name="An01g02220"
FT                   /product="Putative frameshift"
FT                   /function="nucleic acid binding"
FT                   /function="tRNA-intron endonuclease activity"
FT                   /biological_process="tRNA-type intron splice site
FT                   recognition and cleavage"
FT                   /cellular_component="tRNA-intron endonuclease complex "
FT                   /protein_id="CAK43592.1"
FT                   /db_xref="GO:0000213"
FT                   /db_xref="GO:0000214"
FT                   /db_xref="GO:0000379"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016690"
FT                   /db_xref="UniParc:UPI0000EF9E83"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W9"
FT                   /transl_table=1
FT                   /translation="MDIEPTLPIPISYIGGSYFLFSIDAVTYVRREYHICGVLSGTLPQ
FT                   IPQQNVFLGLPLKLMPEEARLLVEKGVACIVDEVKVQKDGMRALMEEDRKKYLRELESQ
FT                   GQHAMRLQNDRKEQQREKALKKIEEKKAAKAKKSAERQQEQQPAPLNNEAAAQDPVVDL
FT                   FANDQEATASDVPSSYPLFAHLHSEGYFLSPGLRFGCQYLAYPGDPLRFHSHFLSVSAD
FT                   WDEELDLMSIVAGGRLGTGVKKGFLIGGAEKKIEGSDAGDPSSVRTFSIEWGGM"
FT   CDS_pept        join(complement(532022..532544),complement(531751..531956))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876767"
FT                   /orf_name="An01g02230"
FT                   /product="Remark: ribonuclease P is involved in processing
FT                   of tRNAs and rRNAs"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /biological_process="mRNA cleavage"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleolar ribonuclease P complex "
FT                   /cellular_component="ribonuclease MRP complex"
FT                   /protein_id="CAK43593.1"
FT                   /db_xref="GO:0000172"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="GO:0005655"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006379"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG329799"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR016848"
FT                   /db_xref="UniParc:UPI0000EF9E84"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X0"
FT                   /transl_table=1
FT                   /translation="MTTPKPHIAHTLLSRAHSPDTASQLFTERIKQKPLYVRPTSPTPA
FT                   DNRSRRRLHRLRKKEYFLRKQKPQPLSARQKRASGLYNLPKEECKYAVFQELHAMWVRY
FT                   MQDMLDLGAKKFKPPMTPLSHGSKLSSADFHGAEVEVVRSRCEGRVGVKGIVVRDTKFT
FT                   FVVVTRGDEVKTIPKEQTIFRFSVPLPEADDADGAAVTGETSADSAKKELVFELHGSQF
FT                   QNRPVDRANKKFKWRNVDYI"
FT   CDS_pept        join(533332..533640,533745..534440)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175606" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654007"
FT                   /orf_name="An01g02240"
FT                   /product="Similarity: shows similarity to several
FT                   oxidoreductases with different specificities "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43594.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG329800"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI0000EF9E85"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X1"
FT                   /transl_table=1
FT                   /translation="MSETNNLPPFPSDIPTAPLLRLSLSKLQAHDITETHNLLQACKDI
FT                   GFFYLDLRDSNEGTNLLNNADKLFPIGERLFDLPLDEKKKYDLASQKSYYGYKAQGAMV
FT                   SKDDILNIAPSLPSPPILQESRPLLESFVRTSHDIVTLLLSILSDSLSLPTSTLPDLHR
FT                   LTAPSGDQIRFIKAPPTATQNPTLGEHTDFGSVTILFNRIGGLQVLPPGADAEWTYVRP
FT                   LSGHAIINLGDAMVKFTNGLFRSNIHRVVAPPGQQAGCTRYSLVYFARPEDEVPLRRLE
FT                   SDRIPALGEGVVEEEISSKDWVIXRALGRRVDLGPVDYEKAAGTEGVSRRLRV"
FT   CDS_pept        join(complement(536335..537781),complement(535646..536275),
FT                   complement(534769..535556))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806674"
FT                   /orf_name="An01g02250"
FT                   /product="Similarity to hypothetical AAA-ATPase AAR34299.1
FT                   - Geobacter sulfurreducens"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAK43595.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI0000EF9E86"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X2"
FT                   /transl_table=1
FT                   /translation="MATITEEPIVAIPVDTPTKNSSHDSAVELLKELQDLRARIQSLEQ
FT                   SNAKITEKAANDKGDNDHSRDDSTSSDAEDEEPKHYPCDDSDDVIMDLRYVKWNEFKTM
FT                   YAEEKRHVIDVLEGPAQYCWQQTERIIRRFGDFALIRGEEGENTSEGDPKPKTDTGGAE
FT                   DDLPERIRINSSLLASLLKDIVSRIDQSAPFVVLRPYKILVGYDQEIRERHRQLAAKWR
FT                   IGSGHEELDDPTLLEPGKEPIDSRQAFRALDCLVSFMDRHLSPVISRHRALLDNFAPSP
FT                   STLDPTISFSNLWYLFHPGMQVACWFTPEQSAPHVQPTNRPSIWKVLQVSEGRPVLNSN
FT                   YSGRVNHFIIRLYKIGYDGERFGVLSRDFHLPHFSGERSIRSLGIVPTRFVDDYQALRD
FT                   KLLKQGELFATFATPQHRFYSGSTLTCHVDGASCPGSFNRRTDYIKGNIIVDFKTARNE
FT                   DQEWVPSLSIPSTMGGTGSEVQKLSIYDDDWVDVELTKDFIRDDAFLARQESAPEQQVT
FT                   RKEVWSDDELVMMPDRACAWDLHRRRWALCDLERMRPVPTDDGWKNLKLRPGHKRMLYA
FT                   QVKRHFSDRKSKEDGESQQVDPDVVRGKGEGLIILLHGEPGVGKTSTAECMAAWLERPL
FT                   YPITCGDLGTSAEVVEDKLNRISAQAEAWNCVLLLDEADVFLAARSKTELERNAIVSGL
FT                   LFLTTNRVGSFDEAFVSRIHLALYYPGLNKGQNHAIWEMNLEKAKARKTSLTIDMDPIL
FT                   EWADANWEQNSKSRTRWNGRQIRNGCQTAIALAEFEAEETSKPVFLQVKHVQQVAAASK
FT                   EFYDYVSRVLGADMAHRAFVERLRLDDWPSNMPADRDLYRVSSNYSPSIRAPEEITSPP
FT                   RNRRRGGGRANDLISSSGGGGAPRTANVHHQWQAGRHDEFDELAFQSPQRHRMQRTPET
FT                   TGRGMSDIHGLPYDDEDEFPDDFE"
FT   CDS_pept        join(538785..538954,539007..539322,539370..539568,
FT                   539643..539990,540046..540989)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876768"
FT                   /orf_name="An01g02260"
FT                   /protein_id="CAK43596.1"
FT                   /db_xref="UniParc:UPI0000EF9E87"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X3"
FT                   /transl_table=1
FT                   /translation="MEPSLMPRMTPEQETHMAKSWLRGHSHRLRLPLSNRSQPQPSAQI
FT                   DLADTRQELDEDVDEVDEFCQVIQCYSNETKGTSEYGDGHGGGRFDIYGAHSWKEVVNI
FT                   VQAVEKDYNHSATGWKGLARRAFRKLGEHAEDFNPWLDLLPDDKYFSIACGGLKIVLGM
FT                   AARRSEQREAILAFFAEIPDIIFWTDRYHSLFQDEEGLKTYLYEFYLALLARIQGTIAA
FT                   LVDVSLWRKIISGLRVKNADKSLGHVNQRFMRARTQLDKHLQFVRDRLQVDTNQGVVYI
FT                   KPIVDNLATEQEIVIQQNSDLGNYVRGFRHEVMTRLERQLNNPSSNFAEQMQQVLRNEL
FT                   QKAQWQINQENMQRESRQWQITRQGYPRSDLYFFLRLNEQDVRQQFIQDLDDTGRDGQD
FT                   IDMAAQTHAQQLLRMPRFQDWIRSDQPDMLHVDGNCDNYAMARCSPFSLLCCVLVHELL
FT                   QQAHCQVLFFFCGLHNLAGEPMAGPVGLVKSLIIQLLLDTDGHYDLLFLTFGRREEALY
FT                   HNDLPTLCETLREMLIQNRSSALFCIVDGASLFEVREWREEMEYVVQRLFSLTIDPDIA
FT                   TAFKVLITSPGISRLASGVPQACRVYVSETNERISDAGFRNPEAFWDEVDRRREDMADT
FT                   AGRYEVNPYEAMYKVDMYSEEYE"
FT   CDS_pept        join(complement(544949..544984),complement(544823..544875),
FT                   complement(544392..544446),complement(544284..544343),
FT                   complement(543384..543868),complement(543263..543329))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110819"
FT                   /orf_name="An01g02270"
FT                   /EC_number="3.1.26.4"
FT                   /function="nucleic acid binding"
FT                   /function="ribonuclease H activity"
FT                   /protein_id="CAK43597.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004523"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0000EF9E88"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X4"
FT                   /transl_table=1
FT                   /translation="MDAIYVIVAVPEVMSLSLFGNTLNGISTSTNRPNLLVMPIPPTIL
FT                   VDHPGTMESEMLEPDEIVVGKRERPNLPPPPTYPSPPWFTSSRFTLTVAVEPNGQPGSI
FT                   GAAAAAFKDASGRFHGETTEDLPSYTAPTNQRAEITSVILGLRMALKRYDQLHSDPWLD
FT                   VTIYSDSAFAVDCMEEWVYKWIRNGWMNCKGNEVANRDLIEEAVVLSDRLKEKGDVRYV
FT                   WIPREENQLCNDLKNARCDEQSSSSDDSY"
FT   CDS_pept        join(complement(548800..549324),complement(548297..548484),
FT                   complement(547679..548242),complement(547427..547621),
FT                   complement(547288..547371),complement(547069..547243))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654008"
FT                   /orf_name="An01g02280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43598.1"
FT                   /db_xref="UniParc:UPI0000EF9E89"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X5"
FT                   /transl_table=1
FT                   /translation="MCHTSLRFPLATTTLGACHSYLTVTLHTYNFLTHPPLARPVPPES
FT                   LFGFYLTFGSRWSFAFFLSSSPPRRQVVNLQFSTILAGDFVPLPACIPPPPPPPSPILS
FT                   QRHVPFPPAHTLHTLYFTSDISSTPGPQDLTAPQPIIRWICPQAVPIPCDPSCWVFHPS
FT                   HRLVGCPKPTVTRSTILPEKMSTQQDPNPSNEGKHDGLSKYVKRMKMALRRSSTVRTTT
FT                   PVMQKSREPEPSQAPAPQRIPQAPTVKATPDATVFTNWGAIQEEKARALFAKYGLTLEP
FT                   GEWRSPSDTTVQRVVRPIRMRVRRTCHRCQTTFGPNKVCVNCQHVRCKSCPHHPSTKTN
FT                   DHRDDTQAALQAIVAQKLHKPVPVQHKPKQPPLTLPSRTGGQDVIHHPTRQRVRRTCHQ
FT                   CSTVFAPDATECSTCQHIRCTMCPRDPPKLGKYPHGYPGDVDAPAEPPARTWKKPRQRV
FT                   RYTCHKCTTLYRSGERNCSNCGQEKGPETIRDPPRRDKPKPDPEIVRRVEERLAKVRIS
FT                   TGANGKSGFSNRLPKLRLFTYVLAPSYDKNSSSASFTLCSSRMPQGTGHATMVGGPSIV
FT                   "
FT   mat_peptide     join(complement(548800..549264),complement(548297..548484),
FT                   complement(547679..548242),complement(547427..547621),
FT                   complement(547288..547371),complement(547072..547243))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X5 "
FT   sig_peptide     complement(549265..549324)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X5 "
FT   CDS_pept        join(551475..551616,551659..551717,551896..551958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876769"
FT                   /orf_name="An01g02290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43599.1"
FT                   /db_xref="UniParc:UPI0000EF9E8A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X6"
FT                   /transl_table=1
FT                   /translation="MKQPKNLNLHRRRSRSEKYSPTGFEGSELGFLLHRFVGTSLEGWC
FT                   WVGTGTGQDTWHENGGGDDDGDILLRIDPPTQNSSSFQHRTE"
FT   CDS_pept        join(complement(554435..554437),complement(554261..554360),
FT                   complement(553982..554112),complement(553719..553910))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876770"
FT                   /orf_name="An01g02300"
FT                   /product="Similarity: all matching proteins are 20-50
FT                   aminoacids longer at the C-terminus "
FT                   /function="actin binding"
FT                   /function="growth factor activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43600.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008083"
FT                   /db_xref="HOGENOM:HBG756690"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR011171"
FT                   /db_xref="UniParc:UPI0000EF9E8B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X7"
FT                   /transl_table=1
FT                   /translation="MSESRLYSFSPETKEKLRKFRLGTSRAKDPQAIIYIIDSKSQEIR
FT                   PEDGEVYSKMEDLADELPESSPRFILLSYPLTLASGRLTVPYVMLYYLPVNCNPNSRMM
FT                   YAGAVELMRNTAEVNRVIEVHEEDDIISIESKLQNAD"
FT   CDS_pept        join(554879..554965,555083..555249,555347..555974)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654009"
FT                   /orf_name="An01g02310"
FT                   /product="Similarity to several bacterial competence-damage
FT                   proteins"
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="CAK43601.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="HOGENOM:HBG460925"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="UniParc:UPI0000EF9E9B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X8"
FT                   /transl_table=1
FT                   /translation="MTSSVLPKNKRTIHTAACLIIGDEVLGGKTIDTNSAFFAKFCFSL
FT                   GIQLKRIEVIADDESEIIEAVRRMSDRYDFVVTSGGIGPTHDDITYESIAKAFGLNLKL
FT                   HQAAFERMKKLSKPHPMQPDFDWDTPSPSLTAKLRMVEIPHDESVPLEEQAVFVAEDMW
FT                   VPIAIVNGNVHILPGVPRLFERLLEHLKPNLLPRLVNPEGKGIYRYLFSTPLPESTVAP
FT                   YLTELATRVASKNIKVGSYPRWGNKRNTVTLVGTDKEFMDSLIAEVEQNVEGTKVTRED
FT                   ELDPPSDTEESK"
FT   CDS_pept        join(complement(558131..558142),complement(557865..557979),
FT                   complement(557523..557798),complement(557217..557452))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233973" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876771"
FT                   /orf_name="An01g02320"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43602.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003577"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI0000EF9E9C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X9"
FT                   /transl_table=1
FT                   /translation="MASKFLREYKLVVVGGGGVGKSCLTIQLIQSHFVDEYDPTIEDSY
FT                   RKQCVIDEEVALLDVLDTAGQEEYSAMREQYMRTGEGFLLVYSITSRQSFEEIMTFQQQ
FT                   ILRVKDKDYFPIIVVGNKCDLEKERAVSEEEGEALARQFGCKFIETSAKSRINVENAFY
FT                   DLVREIRRFNKEMSSYPSGAGGGSRAPEGKMDVSEPGDDAGCCGKCIIM"
FT   CDS_pept        join(complement(565093..565630),complement(564646..565031),
FT                   complement(563926..564560),complement(563523..563860),
FT                   complement(563061..563104),complement(562807..562889),
FT                   complement(562453..562771))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959926"
FT                   /orf_name="An01g02330"
FT                   /product="Similarity to pyoverdine biosynthesis protein
FT                   PvcA - Pseudomonas aeruginosa"
FT                   /protein_id="CAK43603.1"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniParc:UPI0000EF9E9D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y0"
FT                   /transl_table=1
FT                   /translation="MEQGFGPDIIPLEIDMFPMESDNFLMEREFFHMKSDLVSMESGVV
FT                   PMESDIFPMESTIDPQVSERKYENDPLLKAFEIMEIIGRYRTMVPATASDRTSDGNIMF
FT                   LSKMWSQIRAKQPIRMILPAFPFKSPNQGNKTLGSLPDKGEEICLAHLNGLCAAISDVY
FT                   EYGAKLTIVSDGLVYNDILGVSDRDVWEYGHALREMVAENKYDHIEFARLRDLVHSHED
FT                   VKLDGETYERLAPVFRQELIEQHTPVGFDAAVMIKSDENICTTYRGYIKFLTKDLEHLY
FT                   VENGTTSRKAHKKYLGNVAKAMITRGAAFAEAIIKNYSGYIRLSIHPSNGLTKISINVL
FT                   PRSSKPVTPWHSAPCYTVDGRFIYGWREVFDANPELELVHKNGRPWCYRFISELYNWSS
FT                   PVAVDPIYPCGMMITPLNPTSISQVEMEKVQGLAHENSPVVLRGFTDTHDHELIAQKAE
FT                   SVDASYLSISDFNPEEKAEDGDSQDSKSTTLSGWLPYDGPTEIMEDQEAHHIKQCPVSS
FT                   PAKYQLISAPGPISENTRRSLFSASPLFFHHLPASYTVGILQQLSWNAETSSHDTETSS
FT                   LPLIIPHFSHGRPCFRYHSLLSQSNITCDPTLIAIEDISTADSTRLCNILNPLLYDRNI
FT                   PEKYQIQELVRHATTVGNETGKYRHNYATLIRGKAKELQIKWSDPEVTLLLRWSLQHPT
FT                   AFFWGTGIFSKKGSVRPTPLERDTKSSDVKRGEHNVQLITRLKILWSSSPLRFLQGDRQ
FT                   TDRQTARNQQRRPPAGPQALSTLSTPA"
FT   CDS_pept        join(complement(567279..567583),complement(566913..567222),
FT                   complement(566802..566857),complement(566557..566722))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15876772"
FT                   /orf_name="An01g02340"
FT                   /product="Similarity: shows strong similarity to several
FT                   dehydrogenases"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43604.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0000EF9E9E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y1"
FT                   /transl_table=1
FT                   /translation="MATAMAKRLEGKTILVTGASSGIGRSTAKEFARTSPKDLKIIVTA
FT                   RRIDSLQELAKEIKEEVGEGVKVLPVQLDVSNPEDIKKFVPSLPEEFKEIDVLVNNAGL
FT                   VKGVAKAPEIAPEDINVMFSTNVTGLINMTQAILPIFKKRADGGRGDIINIGSIAGREA
FT                   YPGGSIYCATKAAIRSFTDALRKELIATRIRIIEIDPGQVETEFSVVRFYGDKAKADAV
FT                   YAGCEPLTPDDIAEVVVFAAGRRENVVIADTLIFPSHQVSQTSHTGLNSIADGTVT"
FT   CDS_pept        join(complement(572893..572931),complement(572300..572602),
FT                   complement(571928..572129),complement(571543..571673))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876773"
FT                   /orf_name="An01g02350"
FT                   /product="Remark: the human NK cell antigen DX1 has the
FT                   patent-number WO9502611-A"
FT                   /protein_id="CAK43605.1"
FT                   /db_xref="UniParc:UPI0000EF9E9F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y2"
FT                   /transl_table=1
FT                   /translation="MDDEEASVVDIALAARLLGSPGWRVIVYVVDNFSSVLPGTVWLHD
FT                   PDSFQIAVMIYGTKLSVSTGVVGRRQSGCACRGDISQSRRRPVERDPEWHPTPCHWSLS
FT                   PMVDPWDATLLILCPLRNRKQSPRGAAKNQTRINSHMEKAGWLTQFGLDGVEECSSTGF
FT                   NLMRLGHDRAGVDSAASGGYDQGSEDMGACIAGQKMAFISPRLAEDPGWLLPNKVSYLD
FT                   KS"
FT   CDS_pept        join(572993..573187,573259..573295,573349..573416,
FT                   573458..573846,573977..574418)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876774"
FT                   /orf_name="An01g02360"
FT                   /protein_id="CAK43606.1"
FT                   /db_xref="HOGENOM:HBG334119"
FT                   /db_xref="UniParc:UPI0000EF9EA0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y3"
FT                   /transl_table=1
FT                   /translation="MLDEMMGGMLLPRTTDDGTARGQRALVVTAVLTGLSIVIVAMRMY
FT                   ARVGLMKLTGREDYMILISLVLSCTYLGLVAAEVHFGLGKHDADLSDVVVKEQLKSSVM
FT                   KRLWAAIPFYNASLIFTKFSILFQYLRIFPDRRFRLACWIVFGIVATYGTWAVVSGFLN
FT                   CVPVAKFWNRNISGYCLSFEAVWFFNASMNIATDTTLLILPMPLLSQLQLPRMQKFALM
FT                   GVFAIGGLPHSISFLLLEFRLTNEPDSNVGAAYWTAAECNVAIICACLPFLRPIVSRIF
FT                   PRFLSTNSYNRYTRNPTMTASRMTATRMTARSHRQKVELYSQDRDYGMYTIDVKSGEAS
FT                   HDSALDGIAVTTTTMIQETSRNNDESTSQRRLVVDV"
FT   CDS_pept        join(complement(578013..578347),complement(577409..577947),
FT                   complement(576509..577344))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876775"
FT                   /orf_name="An01g02370"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAK43607.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG329809"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI0000EF9EA1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y4"
FT                   /transl_table=1
FT                   /translation="MLASIPQMETVRSLPRNPDMVARHPSAEDLDAAQQLISSAQAGRE
FT                   HLVDRARDDDAARGYDAYDAYDGKHTPTPYDSERPTLPSTESASNTLAERTSPKSQKDT
FT                   SFLGHSCSNCGTKSTPLWRRSPTGAMICNACGLYLKARNVARPTKRNRIQTSTEPVQPQ
FT                   PSQQQPPSIAPQHEAHTHSEGGCHGSKGSCPGGGNCNGTGGAEGCDGCPAYNNRVYKSS
FT                   ARGTVPVHAWGRPANPDSEKPLPAQEPDVPGKSGASAEGNILVSCQNCGTTVTPLWRRD
FT                   ENGHPICNACGLYYKLHGCYRPTTMKKTIIKRRKRVVPALREHSPTAATQSSNGSSASP
FT                   EASPATLARVHDDHYRYYSSEPVDHYGPMSGDRISPAAPKQFGFAPPPVDFTGFSSGPV
FT                   SLPHHPPPPRLLEPDRINAPSHSPVSQFGRRSLSPNPSGNPKKRTLAETASSAEAMSIP
FT                   TTLENGSNQLPPIMSSVNPSPPARLSSISSLLNPNSHDESRLDPSLAALSRQHHQSHQA
FT                   PPLAPPPSQLLPGVSEFDNIREERRLKLQREAEEMREMLRAKERELAELGQQ"
FT   CDS_pept        join(579029..579144,579237..579394,579688..579754,
FT                   579875..580034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876776"
FT                   /orf_name="An01g02380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43608.1"
FT                   /db_xref="UniParc:UPI0000EF9EA2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y5"
FT                   /transl_table=1
FT                   /translation="MEEARERKRERTVWRDGMDRSIVVGGRGGQRRQDKKDRRERKGRD
FT                   LGGAERLVEEVVNEQEGERAEEEIDNRGRKWVSMEMDGGGDDDDDEGSPSVIDLPGGST
FT                   TGGYSFSFFSVDRIFARESSVAQFPHPFFPLCWPIPIPFAYGLPRSNLPGSTASYYGLV
FT                   NWV"
FT   CDS_pept        join(complement(581496..581585),complement(581317..581363),
FT                   complement(581173..581259),complement(581065..581080),
FT                   complement(580460..580674),complement(580295..580364),
FT                   complement(580095..580205))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959927"
FT                   /orf_name="An01g02390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43609.1"
FT                   /db_xref="UniParc:UPI0000EF9EA3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y6"
FT                   /transl_table=1
FT                   /translation="MAFISGHIRVHLLTYSGKLDDEFPISLVDYYPERAELPRVGTPES
FT                   VANVSKPKSTQVADFSVIGKELYRYRKVSRGGGGQKSGNKEKKKEACQSVKKSDAAAPC
FT                   ALCSQCRKVMESLEDDGLHTPEQIGNPEEENKKRAQAKRYFVVVRLGGSLTGFHNIPNR
FT                   DQWDFGLILCSLRSMEARDIVIESPKQPMWLPRIPLTEAPGFGAPMIG"
FT   CDS_pept        join(581952..582025,582283..582409,582518..582618,
FT                   582729..582882)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806675"
FT                   /orf_name="An01g02400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43610.1"
FT                   /db_xref="UniParc:UPI0000EF9EA4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y7"
FT                   /transl_table=1
FT                   /translation="MERSDRLAICEVLLSSVWSRLVGVGRPIGNIFEIAYLRAGVSPSP
FT                   NPGTGRACRTARACGVNVPMEQFACCLSGKPDQITLPTHASMGLSVVIVVGEDESMGFI
FT                   WCDVRLSTHILTSCHHATRPYYLDLRLPTSDLGLRFIIYHLLLIIQN"
FT   sig_peptide     581952..582008
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y7 "
FT   mat_peptide     join(582009..582025,582283..582409,582518..582618,
FT                   582729..582879)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y7 "
FT   CDS_pept        join(complement(584187..584375),complement(583882..584019),
FT                   complement(583698..583813),complement(583546..583635),
FT                   complement(583313..583485))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876777"
FT                   /orf_name="An01g02410"
FT                   /product="Putative frameshift"
FT                   /protein_id="CAK43611.1"
FT                   /db_xref="InterPro:IPR013714"
FT                   /db_xref="UniParc:UPI0000EF9EA5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y8"
FT                   /transl_table=1
FT                   /translation="MGLSSRVFAGAPETRPAESSTQRLGRPAACDSATTMLEPLHLLGF
FT                   PSALFLPTRICQRSLASKKLSPLYPFRYSVFVVEHPTYIPTTGYISRKSSLGLNTCQMD
FT                   LSNIFRIVNIAVGVLMVLGGISQFFPASMSSIIVGIYVILFGLIVGGLEFLPNVPDYVY
FT                   RYASFLFSFLGRGAFYIFVGCILLHDWVLRYIAGSIIGFIGLGYLALEFIPSIEPPSNM
FT                   RENDQGWGAEQV"
FT   CDS_pept        join(complement(585062..585776),complement(584681..584994))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175677" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876778"
FT                   /orf_name="An01g02420"
FT                   /product="Similarity to hypothetical protein SC6F7.17c -
FT                   Streptomyces coelicolor"
FT                   /protein_id="CAK43612.1"
FT                   /db_xref="HOGENOM:HBG329814"
FT                   /db_xref="UniParc:UPI0000EF9EA6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Y9"
FT                   /transl_table=1
FT                   /translation="MKYKSPQVESETDAADAPKRKLDQRDPDISTGEGSLEVEKEQPPT
FT                   KASKSAANTVEEDDEVQEDSGYKDEEFEEEGEEDNEEFDEEEEYDEADDENVDFVKEQG
FT                   GEEEEDQDAEGEEDDEGEAKERVSSKPKLQKVVKEFGRPPLYGTEIAEGRLESSPDTLL
FT                   AMVMDAMLKSRPISHDLTQRAVNKLIEVGYHDIRKLGESSWEERTMVLKDGGYNRYREQ
FT                   GATNLGDLAEFVNEKYDGDLNNLLKKAHNDRDETRKLIKEIKGLGDLGVDLFFNNAQAV
FT                   WPSIAPFIDGRSLETADNVGLGTDLDAIYADLGRDSMSMSRLANGLSAVRLEKRQGDLM
FT                   AI"
FT   CDS_pept        join(complement(587413..587441),complement(587197..587349),
FT                   complement(587025..587110),complement(586871..586974),
FT                   complement(586098..586817))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046303" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654010"
FT                   /orf_name="An01g02430"
FT                   /EC_number="1.4.3.3"
FT                   /function="D-amino-acid oxidase activity"
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43613.1"
FT                   /db_xref="GO:0003884"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG735740"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006181"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="UniParc:UPI0000EF9EA7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z0"
FT                   /transl_table=1
FT                   /translation="MANNRIVMLGAGVSGLTTAYLLSQDASNSITVLAKHMPGDYDIEY
FT                   TSPWAGANYLPYVLQGDHERWERNTWPALRELTKNHPEAGIHFQETIVYNRTKDQGSAT
FT                   GEWFSELVQKDPWYMEVVPDFQDIPADQLAPGIDNASKFTSVCINTAVYLPWLVGQCRK
FT                   NGVVFKRAVLKHVADAANGHHTGQKADVVVNCTGLSSKKLGGVLDDKLYPARGQIVVVR
FT                   NDPGKMVSISGTDDGEDEVVYMMTRAAGGGTVIGGSYQKNQWDPLPDPNLAVRIMKRAI
FT                   ALCPELVEKGQGIEGLDIIRHGVGLRPLREGGPRIEAEKVDGVSVVHNYGHGGFGYQAS
FT                   FGCAEDAVKLVQETLRRKDKAKL"
FT   mat_peptide     join(complement(587197..587321),complement(587025..587110),
FT                   complement(586871..586974),complement(586101..586817))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z0 "
FT   sig_peptide     join(complement(587413..587441),complement(587322..587349))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z0 "
FT   CDS_pept        join(588488..588713,588810..589237,589289..590047)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110820"
FT                   /orf_name="An01g02440"
FT                   /product="Similarity to hypothetical protein K21H1.13 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK43614.1"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI0000EF9EA8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z1"
FT                   /transl_table=1
FT                   /translation="MADAPNGGRIVPIVTTARQHYSSSPTDESMAKTTPQTSQKTKMPR
FT                   NARNKTAEAETLEIPCLNALGLYALPTEGDGNCLYYALSDQTYGDFTHADEIRDRLADH
FT                   ISANKDYFMSFIAAAGGERRAPRRAAAAAARQSYCSSSSASPAPPSAKDKERSFDSKVA
FT                   ESRKKGVWGGAEEIQAFCQAFKKDVCVYTMYGIQNFRDVHAPEGEERDIIHIAFHDFHH
FT                   YSSVRHSDGPHTGLPCIPKVGKEREAEASAAEPTVVDMATPWKISAIQEGLGGKYDQGA
FT                   IVEMLQQCRGNIDRAFMNLLGEDSNTSLADAPSSKAIMKSRLQASSRSSSPFSVGSKRS
FT                   ADESDADDSPQPAVRRTRTRESKRRILPDVMVGIEFRDDQNDLVSLRLRVSPDTVVPKP
FT                   AVQPSTEQAEASSLESATDSPSLLPQDRKLRIRSKTVSSETSSIPNESSDERKPPRRSQ
FT                   RISRTRPAPRSA"
FT   tRNA            591462..591552
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        join(complement(594085..594621),complement(593847..594032),
FT                   complement(592328..593782))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175699" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959928"
FT                   /orf_name="An01g02460"
FT                   /product="Similarity to hypothetical protein EAA66045.1 -
FT                   Aspergillus nidulans"
FT                   /protein_id="CAK43615.1"
FT                   /db_xref="HOGENOM:HBG325012"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniParc:UPI0000EF9EA9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z2"
FT                   /transl_table=1
FT                   /translation="MGGVGIWCMHYIGNRAIVLGNGEAQFQIIYSMTFTGVSFVLPVVV
FT                   LLVAFYSIGASEKAGYIRILTGGVLTGGAVCGMHYIGQLGISNYRCSYRVANIVGATII
FT                   AVFASTVALTVFFRWRATWTDSWWRRGICGCVLALAVSGMHWTAAVGTYYYNHDTTMKH
FT                   NGQLSRSQVVIISSVLACAACGVLTACAVVAGGNRRRLNIQARQLVLTCAFFDQSGRIM
FT                   VTPHALLPSRKIVDRYVGRTFNDDDLTRSHPAFLWAFRASRHWNLVKDVVPFMRSRIET
FT                   DKEATEHFLAKGEALDQENELQNDFDELFKRHFCVTAQDLADEVRQPLPALGKLYDDVL
FT                   VTTAPTSRFSRAMGYSRLNNSKGQMLFTVRHLDKQEANRLAAAGFRFTAVENVTSVLSS
FT                   RMHIPLPVLGEHLKDMRDYATGGRNYEPGVHLVSFVMRPTISDHFEVLTAKGTGNPLPS
FT                   STLPIKRINIQHLDLISHMEGWTISTCLSWLKSEAAQSNKEIDDFREQLIHAMTSLESA
FT                   LPPDINMASKFSARPLIAPCRMFSDSDASNSILLPFCAVGNLDTQVSNPDFTFMPLRLF
FT                   RAQQQLNDANIGSDGFAKELGRELYYSNARSSSATEADITPSIRSVLKLWPRKHADSPH
FT                   GDLSQETLTELSQLGDIMVRKEVKVDVAKLSTRSLDSAKHASHATVVAGDLATSSYVDE
FT                   LYNLCYSPGVRLRPDTAITRSSVTRSSMATG"
FT   CDS_pept        join(595077..595142,595217..595347,595413..595463,
FT                   595544..595732,595820..595939,596047..596166,5
FT                   96268..596442)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876779"
FT                   /orf_name="An01g02470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43616.1"
FT                   /db_xref="UniParc:UPI0000EF9EAA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z3"
FT                   /transl_table=1
FT                   /translation="MAFSFQELHAAGPYYVLAMVLQWEPLIACGGHRDPSNFYVGCTRP
FT                   INMRGPQNEGLALFQRSHWAITIDRGCNQEPWGIEFTGKLKFFPSAKVGYYLSTRWVYV
FT                   YGSRRIRTAKANPVGRGPRRFSCAVWLNLRSSPKINQFCTIGLPLMARSPSAHRSQLHR
FT                   LNHPLATNTSRVLNLGSNYPEGPADSPIASTHAVDKDPEWSVDAVAGLARGTSIGNHAI
FT                   HRHGLAPLDELNVAEWEVREGERSRRSSEMHSRWTITRALGHFGVRQQPRDSDRGFLFS
FT                   IG"
FT   CDS_pept        join(complement(597539..597616),complement(597180..597479),
FT                   complement(596831..596926))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876780"
FT                   /orf_name="An01g02480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43617.1"
FT                   /db_xref="UniParc:UPI0000EF9EAB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z4"
FT                   /transl_table=1
FT                   /translation="MDLPSPIAARLDRIGVRPRYPGISWIAWSGAVSAYQLLLFLGAVE
FT                   GWRIFLDTSIVIYICDGGMKDPISWAAAPVLSAQLGKGDKFINLAAAACRLMLVLLCVD
FT                   VLTAGQRCFYGMVMELETFPSMGLTGRIWRIINWLSRSRATTTAAAADGTRRS"
FT   CDS_pept        join(complement(599145..599448),complement(598989..599064),
FT                   complement(598824..598933),complement(598714..598733))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876781"
FT                   /orf_name="An01g02490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43618.1"
FT                   /db_xref="UniParc:UPI0000EF9EAC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z5"
FT                   /transl_table=1
FT                   /translation="MVSSVQLTSCDLLRTFRFCANNLIFHTLTFWGGGGGGIQTNHTTS
FT                   YVFLTSVTGMNRGSNTPSSYAAAITLPGQLLTNLRDPLVEKIVVKVFHVAVPGCSYKWE
FT                   YLGRWLQIDPDDCTNTGQAEYGCYGPKYEQYINRPEIENRLSLSYISDALFSGIHLSID
FT                   QHELMG"
FT   CDS_pept        join(complement(601137..601165),complement(600708..601005))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876782"
FT                   /orf_name="An01g02500"
FT                   /product="Function: thioredoxin is involved in oxidative
FT                   stress response and redox regulation "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="CAK43619.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI0000EF9EAD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z6"
FT                   /transl_table=1
FT                   /translation="MSHKVHDITSKAEFAEKVTNSTDAIVLDCFATWCGPCKAISPKVE
FT                   EFSNTYPNAKFYKIDVDELSEVAAELGIRAMPTFLLFKDGKKFDDLTGANPKGLEQKIQ
FT                   ALLA"
FT   CDS_pept        complement(602579..604975)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876783"
FT                   /orf_name="An01g02510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43620.1"
FT                   /db_xref="HOGENOM:HBG329819"
FT                   /db_xref="UniParc:UPI0000EF9EC6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z7"
FT                   /transl_table=1
FT                   /translation="MAIWPFGRKNKRHTIQLDAPAVADVQSSQEPRHSFDDGKLGRLSR
FT                   KHSKRQKNRHAQPVEVVPSFLHDASHPTSSPVVQYPPPTSHSEQPTPMKENRVPVSRAG
FT                   QHSDAYTTYSTMSHEQPSLSRSASLLKSKRNENGPAVLKKKLSKRKAYEIAREREIRML
FT                   ASAPIDIPRRPSPLPGEQFSIETRRANGAQSRRSDRHCSDTSLSMRDSAASSLSDIFES
FT                   YTFKVNTFAAWTPRPVIRYVEAPRVSTAKSQRPSEPSIRKDKTPAYATHNEHSRSKKRV
FT                   DKLADDLDAGALRELLERDRRRRERKQLEDQARLHRKLQRAAEQQRQAEAEAEADAVPQ
FT                   EPSSEAEDTSLAPRGRPGAESRAVSDRSKEYAPRTNETNAFLGGNSSGSWLRGASKDTD
FT                   RRGRESVDSVHVIGNIDDSSIREPKLVMRRSFAPSQDMGMSGSSLSHSPSRRELYSPTS
FT                   SQLYGIGRESTSDISRTIDSDRRLSDHGSGRVNTLTSIFRRGSSRLKRSYRERFHERSP
FT                   EHSNPSHESFFKVQTQSSGPPPSFVTAPRTFLGSGTIKRSQSKFTEHFGDEPLSPPDSR
FT                   LQSPDIPEVLDEFEREDEMSDINMGTQYPIPSSGSEPQDIPRNPHHSWTGDSWEGDPDN
FT                   LPLSQSLASIDSEGSWMSGQFLRRISQKKASNPLRTSLSSSRNIMEEGHEGSSNGDDVP
FT                   VSEPLVRFGTNQDEGLKSGPDVAGASPDKDSPMDSVPEQAEETWHDQIARRPVLVTPAI
FT                   RPKSNEGLLKNVQSFCAEEEFSPIEEHSAEFELETSDNHGNGRSN"
FT   CDS_pept        join(complement(606296..606308),complement(606004..606214),
FT                   complement(605969..605973),complement(605868..605887))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876784"
FT                   /orf_name="An01g02520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43621.1"
FT                   /db_xref="UniParc:UPI0000EF9EC7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z8"
FT                   /transl_table=1
FT                   /translation="MYGVKNITEKIKRPGGGFGLVPSGSAVTAGPGEGRRCVTTNQPTR
FT                   SPGSETGGFVCVSALSVPRSRLLTVLSTSDNRKTAAR"
FT   CDS_pept        join(complement(608170..608236),complement(608018..608070),
FT                   complement(607903..607995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876785"
FT                   /orf_name="An01g02530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43622.1"
FT                   /db_xref="UniParc:UPI0000EF9EC8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Z9"
FT                   /transl_table=1
FT                   /translation="MAVKIVNLLACGQRKLDGLGAGSDGGAQNGEKLANSRPMEVSKTL
FT                   LSTRLTPYDQPAVIPIGYRWSCTDP"
FT   CDS_pept        join(608463..608548,609190..609418)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876786"
FT                   /orf_name="An01g02540"
FT                   /product="Similarity"
FT                   /protein_id="CAK43623.1"
FT                   /db_xref="UniParc:UPI0000EF9EC9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q800"
FT                   /transl_table=1
FT                   /translation="MGKSAGLDRIELRQWLTLVSCDERLDCPGSETFRLTNIRWKEIGR
FT                   AQVAASFSCLACTEARAGGRRPLLMGFYSETSAWLNSVQHSARQGKVANTPGTMVLEQL
FT                   "
FT   CDS_pept        join(complement(610486..610545),complement(610240..610292),
FT                   complement(610068..610143))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654011"
FT                   /orf_name="An01g02550"
FT                   /product="Similarity"
FT                   /protein_id="CAK43624.1"
FT                   /db_xref="UniParc:UPI0000EF9ECA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q801"
FT                   /transl_table=1
FT                   /translation="MVWAPRAGGLGIEMAGFFLGHDAVDKGLFAVITSSDVGIFPAVEG
FT                   YYTGVLSCILAVARAID"
FT   CDS_pept        join(610974..611159,612025..612255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876787"
FT                   /orf_name="An01g02560"
FT                   /product="Similarity"
FT                   /protein_id="CAK43625.1"
FT                   /db_xref="UniParc:UPI0000EF9ECB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q802"
FT                   /transl_table=1
FT                   /translation="MLHFVVRIFTILIYYELPTQATTRITCGINKRHPDGRLTGWTRAR
FT                   STSFHTKVKSTIRTTDKPVRLAFRNTISTTNMPTEKLLYGPGLIVAFLRSTSSSLFIIT
FT                   TIVVASYMAEERPSSFVRFRITEIQILLVCVASE"
FT   CDS_pept        join(612991..613178,613277..613304,613416..613452,
FT                   613509..613598,613667..613743,613826..613891)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876788"
FT                   /orf_name="An01g02570"
FT                   /product="Similarity"
FT                   /protein_id="CAK43626.1"
FT                   /db_xref="UniParc:UPI0000EF9ECC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q803"
FT                   /transl_table=1
FT                   /translation="MLGTGKLSLRGHRHHTHCDHSGSLGGAAGQIVKTERGTRSMVCRP
FT                   GLRASSEAAWRKIQCWDRRVRSLADALADSSLRTSFVSDVRTAWVNVCPLVATVHCLEL
FT                   YAHTGAAEIHAGCQVLVSICWTFGSVGHDTDILSGSVMGSRRLGQSSTDVLSDVSAQ"
FT   tRNA            614207..614278
FT                   /gene_name="tRNA-Met (CAT)"
FT   CDS_pept        complement(614462..614635)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876789"
FT                   /orf_name="An01g02590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43627.1"
FT                   /db_xref="UniParc:UPI0000EF9ECD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q804"
FT                   /transl_table=1
FT                   /translation="MEDIITTGSGSNDRMQQQQRGGGQSSRASPVLCVLAGLASLKGGQ
FT                   LVTCWYSDLNHG"
FT   CDS_pept        join(614759..614780,614879..615002,615065..615253,
FT                   615305..617420,617475..617570)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654012"
FT                   /orf_name="An01g02600"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAK43628.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="HOGENOM:HBG604608"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniParc:UPI0000EF9ECE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q805"
FT                   /transl_table=1
FT                   /translation="MASRRCPFKQFIRNVRSAKTIADERAVIQKESAAIRASFREESHD
FT                   SGIRRNNVAKLLYLFTLGERTHFGQIECLKLLASHRFADKRLGYLGTMLLLDENQEVLT
FT                   LVTNSLKNDLNHSNQYIVGLALCALGNIASVEMSRDLFPEVENLMSTANPYIRRKAALC
FT                   AMRVCRKVPDLQEHFLEKAKTLLSDRNHGVLLCGLTLAIDMCEAEEAEEGQEGVIEMFR
FT                   PLAGGLVRSLKGLTTSGYAPEHDVSGITDPFLQVKILRLLRVLGRGDAATSEMINDILA
FT                   QVATNTDSTKNVGNAILYEAVLTILDIEADSGLRVLGVNILGKFLTNKDNNIRYVALNT
FT                   LNKVVAIEPNAVQRHRNTILECLRDPDISIRRRALDLSFMLINESNVRVLVRELLAFLE
FT                   VADNEFKPAMTTQIGIAADRYAPNKRWHVDTILRVLKLAGAYVKEQILSSFVRLIATTP
FT                   ELQTYSVQKLYLSLKEDISQEGLTLAATWVIGEYGDNLLQGGQYEEEELVKEVKESDIV
FT                   DLFTNILNSTYATQTVVEYITTASMKLTVRMSDPAQVERLRRFLSSRTADLSVEIQQRA
FT                   VEYVNLFGYDQIRRGVLERMPPPEIREEQRVLGAPTKKRQSKILKDKSKKPAKQAEQDM
FT                   LLDLMGGDAPPTSPTTNGSQNTADLLADILGGDSSLSSPSPQPAQKAAGSTNTSAIMDL
FT                   FNTNGSTPSPKPAEPASSGLDLLAGLSSSASPAPTPAPSATPAHTAFNKNDLSLALQVQ
FT                   RGSGGSAQIQARFRNNSSFGRFSNVGLQAAVPKSQKLQLSAINKADLDAGDEGIQMLKV
FT                   AALTGALPPKLRLRLRITYAKDGSDPVTDQVDWTEP"
FT   CDS_pept        join(complement(619967..620246),complement(619809..619919),
FT                   complement(619534..619757),complement(619092..619166),
FT                   complement(618864..619004))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876790"
FT                   /orf_name="An01g02610"
FT                   /product="Similarity to EST an_2155 -Aspergillus niger "
FT                   /protein_id="CAK43629.1"
FT                   /db_xref="UniParc:UPI0000EF9ECF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q806"
FT                   /transl_table=1
FT                   /translation="MGRVELLAYRPVESRQMVVGQVLLGTAAMRAAINWRTRSPWQGEQ
FT                   RSLVVARKSPDTNEIERRSRYKWCFSNGEDSMDETDDDAGSNGIAIDEQEEERERARDR
FT                   KNEEPRDAADGLRTLLRFPYAVSLGIGGSQYGITRDVGLTSSSSSLSVMHHAIYNGIHL
FT                   LESLCREYTTERLKDSDFQTWLSPSSSVFSVNSPRSEAMAPAARLLSGTSAAQRSEDGG
FT                   DKDKGIHQGRILAQYSGAMTAKYHITITYLLPEAIMKQPVKNAIGVLVPGQCDQ"
FT   CDS_pept        join(621072..621231,621613..621723,621789..621916,
FT                   622013..622270)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876791"
FT                   /orf_name="An01g02620"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43630.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000EF9ED0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q807"
FT                   /transl_table=1
FT                   /translation="MSSTSPSKEPEVEPEVQSGEDQEQMDKEQQDTQAQGQGEFEVKEQ
FT                   DRWLPIANVARIMKLALPENAKIAKEAKECMQECVSEFISFITSEASEKCQQEKRKTVN
FT                   GEDILFAMTSLGFENYAEALKIYLSKYRETQSARGEHQNRPTSSGYGAGAPVGAPGPAG
FT                   PGGRPMAPGAGFPDAADSANNIMNQSLDPSEQDTSAYGYPPMVGQPHNGTAGESY"
FT   CDS_pept        join(complement(624509..625761),complement(623303..624449))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876792"
FT                   /orf_name="An01g02630"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43631.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329829"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EF9ED1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q808"
FT                   /transl_table=1
FT                   /translation="MSMKDLAYICYSSPGSNENSPLGSAACVHCHRRKVRCDARIVGLP
FT                   CSNCRSAGKTDCRIHEKKKRLAVRSILDPVPIRCRPPPASSEPTHRHSLPLTATTPPDA
FT                   FTTTFRGVQPEVTTPVAHPASSLHNLHQTLNHNVNHHPPHNGAGSAAESPTYNRPAGQD
FT                   VSAESDSHADLEKRLVKLIDEEESGSREIRRGVRAIYVGHELSNMSFLIRQQRDKDDDV
FT                   YHFAGNEIPRRQLRTGHDQLLMDALTLPEPALADELVQAYFDHVNPGYPIIDEDLFMAQ
FT                   YRNRDPADPPPILLLQAILLVGAHVTRPKAERDALKDIFFRRAKWLFDSRIERNRDILV
FT                   QAALLLTWHSDGADDDVAANAHYWVGVAARIATGLGMHRNPISSRFVSRDRRMWRRLWH
FT                   IIVQFDVMVSLSYGRPQAINLEDSDVSPLTISDFEGCGPRVQSDYVIHFTELSVMISYI
FT                   VRSRFGLRVSAERRKAVLLEADEALANWSLKLPDKLRLRASDMDPWSAMLHLTYNNFLI
FT                   LLHRPHPRASAYSDDYGPHDAEICSAAAGVITSIFEELRLNDRLKFLWYSGVHTLFTAM
FT                   IQVRVELRFSNPVLAINALRRFDSASYSLRELASYWFHANTILRLFEDSRRLQEDLRMA
FT                   TSERPPRRFSNPQDQLKTTLHSTTTSTSAPTAMQTPRPPNPTPTDRPLPFEVPTPDSST
FT                   NHLPTSPHHSHPQPQSQPQQHHHLDAWIPPPPPSATMTPVVDAIDADAPRESLDWRQLF
FT                   SFTDLDQPVLPMAMEGLPELEDEWRQIYWQETPMSDLLLDGGWMHG"
FT   CDS_pept        join(complement(627870..628193),complement(627656..627779),
FT                   complement(627452..627575),complement(626938..627395),
FT                   complement(626570..626880))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806676"
FT                   /orf_name="An01g02640"
FT                   /EC_number="2.1.1.-"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="CAK43632.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG328674"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0000EF9ED2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q809"
FT                   /transl_table=1
FT                   /translation="MTYTNVSTVVEQCTNGDHTNGYHTNGHHTNGIHSNGHGPSKSDVN
FT                   VDTIAISPNAPDAVPTLIDQIASHKSISLENSVERLRLRDAARSLANALETPREAIVRQ
FT                   CWTTATLHAAIETALAIGVLSELSRDKPKSVAELAVITQSDPVLLSRIMKHLASMSVIT
FT                   EAGPDEYIATNLSTTLSVERYGDAFPALSAWLYPGIYAIPAFLKQTGFRNPTDPTKSPF
FT                   QLGQRVDEHFFECVQKNPTLNKQFGNHMSVYHQGRPSWMDKGFYPVQERLIKGTELSEK
FT                   DVFLVDVGGSTGHDVSEFRRKWPEVSGRLVVQDLPQVIETVRDLHVSIDPMAHDFFTEQ
FT                   PVKGARVYYMHSVLHDWPDDVCGQILSNLIPAMKPGYSKLLINEYVVPSLDAHFETTSL
FT                   DMIMMSIASGERTEKHWTTLIESVGLKVVKIWTVEKGVESLIECELA"
FT   CDS_pept        join(complement(630108..630232),complement(629894..629983),
FT                   complement(629542..629765),complement(629231..629320),
FT                   complement(629097..629149),complement(628892..629004),
FT                   complement(628416..628536))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654013"
FT                   /orf_name="An01g02650"
FT                   /product="Similarity"
FT                   /protein_id="CAK43633.1"
FT                   /db_xref="UniParc:UPI0000EF9ED3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q810"
FT                   /transl_table=1
FT                   /translation="MALPRIVQERGIKFSLELSPDKEHARHSRVQETFRVGKSRRRSDF
FT                   RTSLPGVRFHQRRRRRHAPSGTVLSLALHFFLEIDDQMIASVRNLKAPPNTDIKPPPPT
FT                   ATFKAEHQESLELLVWPRRSTMFLAPQSCPTAKYTVATRSYRGAPPLLLLRYGCSWQYW
FT                   RSTTLSETRGKSGTIGILCTYTTPISRILSGGGTLSYERMPIPELRLHISQAYLYCYFR
FT                   DLVSGSAALRRRRYISDSTAGHQSGQPESEINDQWRWQQLAYLFDLAPQ"
FT   CDS_pept        join(630725..630895,631054..631349,631403..631647,
FT                   631707..631737,631815..632175)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876793"
FT                   /orf_name="An01g02660"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An03g05810 - Aspergillus niger"
FT                   /protein_id="CAK43634.1"
FT                   /db_xref="UniParc:UPI0000EF9ED4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q811"
FT                   /transl_table=1
FT                   /translation="MTAVSSEYAHQTKGPRILAVFWTMTSLAILAVAARLFIRIKVLRN
FT                   PGADDWLIATSMTRTRSASQLYQLRLGHNLLRLTQISRGCPAEPFSESDNDTTRDLMGI
FT                   DGVCGTGVVYLHLGALYHVRSSESSLGHVPSVKGRELPELVDPCGLCHLHWSHICLYGS
FT                   VFGNLSDSHLTKASYVDAETIGVVCSAGSECSVSKNSRSSSSSVLAKKQGYSACAMAII
FT                   KCMQLPGLADLSDTTYATADLVIWTSIESNVVILASCIPTLQPLLEIILGKRSLRSTGG
FT                   YQYKESSTQLPESNKWSSKRSGHRKSKGNMMIADIGSQDSILQIGDDHEDESHYMGHIR
FT                   RTDKITVVYESVTPQPGGGDKTNDPVK"
FT   sig_peptide     630725..630823
FT                   /db_xref="UniProtKB/TrEMBL:A2Q811 "
FT   mat_peptide     join(630824..630895,631054..631349,631403..631647,
FT                   631707..631737,631815..632172)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q811 "
FT   CDS_pept        join(complement(633514..633703),complement(632522..633483))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211800" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876794"
FT                   /orf_name="An01g02670"
FT                   /product="Function: the S. pombe scn1 protein interact with
FT                   the CUT9 protein"
FT                   /function="endodeoxyribonuclease activity, producing 5'-
FT                   phosphomonoesters"
FT                   /protein_id="CAK43635.1"
FT                   /db_xref="GO:0016888"
FT                   /db_xref="HOGENOM:HBG329832"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="UniParc:UPI0000EF9ED5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q812"
FT                   /transl_table=1
FT                   /translation="MSETDQNDAFPWHLGVFDAHCHPTDTMSSIAEIPQMKVLTLTVMS
FT                   TRGEDQDLVLQTATSLTQGPVLPCFGWHPWFSHQIIDDTTGSPKTDESTSPIELKKLHY
FT                   KKVLTPEPDDDFILSLPDPKPLSELLSESRARLLAYPRSLVGEVGLDRAFRLPKAWTEE
FT                   EKETRDERMTPGSREGRQLSPYRVQLAHQKAVLEAQLRLAGELQRPVSVHSVQAHGAVF
FT                   DLLKALWSGHERKNASRRERRRRYSVPDAHAESDAEDERMQQKPAKSDEKSLPFPPRIC
FT                   MHSYSGPVEPLKQFLHQSNPSDVYFSFSSVINFGGPSSQKVINVIKALPDDRILIESDL
FT                   HTAGQQMDDLLEEIARQICNIRGWELHQGVRQLAENWKRFVLG"
FT   CDS_pept        634142..635380
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876795"
FT                   /orf_name="An01g02680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43636.1"
FT                   /db_xref="HOGENOM:HBG329833"
FT                   /db_xref="UniParc:UPI0000EF9ED6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q813"
FT                   /transl_table=1
FT                   /translation="MSSISAFLSLPLLTLFSLPLALLACFTTFLSIIFLLLRFSVIYIE
FT                   LCLAIITNYFVIPTAANTSLLNFSASEPTTPAASTTPKRRSVDHSLNNGLLTALATYRP
FT                   GYNPPRRTNSLTTTTSTSSTSQDTTTVPLYRKDEPANNAPSALLTLISGDEGRDFEGLG
FT                   GWRCATTAKAAAATTTTTARYPAHHLLSDTASPSPNITTSEYDERAWLSINERLELPSQ
FT                   PLLSIRNNSNSSNNEALESLPWRHRQMASTSPPPGGSNNLIRSPRHHHRSATTSLLSTS
FT                   LSPRSSLPDAVPHHGLDHPQRRATSPLLSQQQNSTNTLFCTPSPTGKFPGASIPRVSSP
FT                   TEGSGGYFSLRPGSTSSTSGSTTPGEERRSPRPSAKSMVHYPAGVRYRRRSMSGPNSGV
FT                   KLTKASSGTERAL"
FT   CDS_pept        join(complement(637416..637583),complement(636251..637348),
FT                   complement(635816..636091))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876796"
FT                   /orf_name="An01g02690"
FT                   /protein_id="CAK43637.1"
FT                   /db_xref="HOGENOM:HBG329834"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI0000EF9ED7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q814"
FT                   /transl_table=1
FT                   /translation="MASESFNSPSGEFRGRSQEPVASRRESTPHAARGASATPAPLAWF
FT                   PLGYREGFSQWWASLPAATAEHRVLSHLPYLQHQPPTHLQTGKTSSVSGGTGSLQSADQ
FT                   TQQGEVSASSTNDPYGPRMWRSSMVELSGKNRALNEFSVERIGEEADQHLVMLHGYGAG
FT                   LGFFYKNFEPLSRLKGWQLHALDLLGMGRSTRPPFRIKAKEREEAIKEAEAWFVDALEE
FT                   WRVKRNIDRFTLLGHSLGGYMAVAYALKYPGRLNKLILASPVGIPEDPYAVRAEMPAPN
FT                   ESTMANELTQNQRNIAESASSVPPTELQKGDNNILLKGSPTDSGASQDRPPRRMVPKWF
FT                   AYLWDANISPFSLVRWAGPLGPRLVSGWTSRRFSHLPAEEAKSLHDYSYSIFSMRGSGE
FT                   YALSYILAPGAFARSPLIRRIEGNGLPIIFMYGDHDWMDVKGGLAAKAKLDQEKERILQ
FT                   NATVEEREADNGSAKVVIIKRSGHHIYLDGWEDFNRIVLAEMEEVAQKERANRAS"
FT   CDS_pept        join(638437..639055,639150..639832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211767" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876797"
FT                   /orf_name="An01g02700"
FT                   /product="Similarity to hypothetical protein SPBC902.03 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK43638.1"
FT                   /db_xref="HOGENOM:HBG323873"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="UniParc:UPI0000EF9ED8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q815"
FT                   /transl_table=1
FT                   /translation="MASASLDQLVKGSPAPNSRLASSATSSSESLAPAFHSHPPSSDPS
FT                   SPPRSSTPDPLSTLPSSPPQIYLNLLILESSLRAQYLALRERRRQNTFFLLLLAAWIAY
FT                   FAYALFLRPREDGRGVGGSVYWVVEMGEKVALMGGVVTALLVWGTGQWERGVSLAAALA
FT                   RRSQPRPPHHEHQDRGHPRSLVAGAFLLPFFPISILCTLFPVPRLVQEDLSPGGDYIRL
FT                   LLLPKSFSPEFRENWDEYRSEFWDKENDRRAQLRQKLRQRERQLVQQDGGWFWWFGLSW
FT                   KASQRRRVAAATISRPGDADKVQHRSHHHHHSSSISKLALESKSPLRRGGPRSESHSRT
FT                   PSRSTTPVDTDDRPPSRSSVSGRPRRGSTSPSTEQHIQQSRKKKASKAATRGLSPLTQA
FT                   QIREGVRTPSFSSDDSSFMGTPSEKEKPKDESVE"
FT   mobile_element  complement(640599..641037)
FT                   /mobile_element_type="transposon:Vader"
FT                   /locus_tag="An01e02710"
FT                   /note="Remark: Vader is flanked by 44 bp inverted repeats
FT                   (IR)"
FT                   /note="Title: transposon Vader - Aspergillus niger"
FT   CDS_pept        join(complement(644398..644464),complement(644321..644339),
FT                   complement(644197..644248),complement(644081..644127),
FT                   complement(643925..644030),complement(643606..643869),
FT                   complement(641477..643548),complement(641378..641414))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876798"
FT                   /orf_name="An01g02720"
FT                   /product="Complex: the six S. cerevisiae MCM proteins "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43639.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008046"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI0000EF9EF9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q816"
FT                   /transl_table=1
FT                   /translation="MEGQFDDAAQDRVRAAVEFLDPSDARARSYRADILLMLNRGLRRL
FT                   IVSIDEIRAHNREMADGLLTSPYEYSDAFEKALKEIIKTLPNRPSRETGDDVNYHCGFV
FT                   GAFGEYSCNPRTLGSSHLNRMISLEGIVTKCSLVRPKIIQSVHWSERGQKFLTRKYMDA
FT                   TMTASGATSMSIYPQEDEEKNPLVTEYGFSTYMDHQTISIQEMPERAPAGQLPRSVDVI
FT                   VDDDLVDRAKPGDRIQLVGVYRSLGNRNASSTSATFRTLVLANNIIQLSSKSGGGIAQA
FT                   TITDTDIRNINKVSKKKGVFELLSHSLAPSIYGHDYIKKAILLMLLGGMEKNLDNGTHL
FT                   RGDINILMVGDPSTAKSQLLRFVLNTAPLAIATTGRGSSGVGLTAAVTSDKETGERRLE
FT                   AGAMVLGDRGVVCIDEFDKMSDVDRVAIHEVMEQQTVTIAKAGIHTSLNARCSVLAAAN
FT                   PIYGQYDPHKDPHKNIALPDSLLSRFDLLFVVTDDIEDSRDRMVSEHVLRMHRYRQPGT
FT                   EEGAPVREQLHQTLGVGLEDTQDSNQPTDVYEKFNVMLHAGMAHMSRSKSKNIEILSIP
FT                   FIKKYIQYAKSRVKPVLTKGAADHIVATYSALRNDELSGNQRRTSPITARTLETLIRLS
FT                   TAHAKSRLSNRVEERDAKIAESILRFAMFKEIVEDERRKRRKVASFDEDSESSDSDSDD
FT                   DDNTPAQTSSATPRSTRRGGLRSRGANARSTTNEDTEMDADGDAVSEDGDGLYNASPRG
FT                   QRLRSSQTSRTQTQTQSQSRMSVASSRPASQLVESQTDNSQSQNTTVSSEPIQPARLTV
FT                   FRQALGPLMGTRLFTHGDTADVESLIGAVNTALRSTPSLGESHVFQRGEAIQALRAMNE
FT                   RNELMYLEEDETVYRI"
FT   CDS_pept        join(complement(645593..645659),complement(644902..645521))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234472" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876799"
FT                   /orf_name="An01g02730"
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAK43640.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniParc:UPI0000EF9EFA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q817"
FT                   /transl_table=1
FT                   /translation="MLAATLLSLSAVAVALPASTYDALPTAGTVINLDITALNETYTVQ
FT                   ENDTLSAIAAKYGVGTCDLARLNILADPNFIYAGEVLRIPAQPTFPDDLSCFSTNNTEA
FT                   TNTCIDSGPHVYTIMPGDTIQKIANERFNITVESVINQTAQTGYIAALNPGPYDVLQTG
FT                   ETVKIPICDNTACTMTQFTLGYGTLQDFATYYGVAVGQIMALNLGYNHSEAAVPLGVLY
FT                   DCSAVN"
FT   mat_peptide     join(complement(645593..645599),complement(644905..645521))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q817 "
FT   sig_peptide     complement(645600..645659)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q817 "
FT   CDS_pept        join(complement(647435..648481),complement(646643..647362))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959929"
FT                   /orf_name="An01g02740"
FT                   /product="Catalytic activity: the A. oryzae tannase
FT                   converts digallate and H(2)O to 2 gallate. "
FT                   /EC_number="3.1.1.20"
FT                   /function="tannase activity"
FT                   /protein_id="CAK43641.1"
FT                   /db_xref="GO:0050318"
FT                   /db_xref="HOGENOM:HBG325297"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="UniParc:UPI0000EF9EFB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q818"
FT                   /transl_table=1
FT                   /translation="MYSLAAATLVGVASAASLNSVCTTDYVTSVLPTASDDIPSGITID
FT                   TSSVSASIYRNYSLTDSIFWEDLTINFCEVSFAYSHQNGDDRVVVQYWMPSPDLFQNRF
FT                   LATGGSAYEINNGSGGGDIAGGVAFGAATGYTDGGFPYWGGTDFDDVVILGNGTANWPA
FT                   IYNWGYQAIAEMTQIGKAFTNNFFNVGNNVTKLYTYYIGCSEGGREGMSQAQRAPELYD
FT                   GIVAGAPAMRYGQQQVNHIAPPIQIQTIGYYPPSCVFDTVINATINACDGMDGKIDGVV
FT                   ARSDLCFQNFNVSSMLGKSYYCEAGSTTSLGLGYGKRSKRQTTSATPAQNGTINAKDIE
FT                   VIQDLLTGLKDSNGDLVYFPFQPTAGFGDTTVYDSTTDSWTITSPNSNGEWITKFLNWQ
FT                   NVTDLDMWGVTNDDLKAWMIEGMTKYMDSLQTTLPDLTPFHSKGGRLLHYHGEADSSVP
FT                   PTGSIHYHESVREIMYPDLSFAEGNEKLNDWYRFYLVPGAAHCATNDEQPNAGFPRDNF
FT                   AHMIKWVEEDVVPVRINATVTSGEHKGEVQELCTWPSRPYWTDNNTMVCEQNATSIQAM
FT                   LWKLSAYLTPVY"
FT   mat_peptide     join(complement(647435..648436),complement(646646..647362))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q818 "
FT   sig_peptide     complement(648437..648481)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q818 "
FT   CDS_pept        join(649696..649739,649792..650197,650247..650372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876800"
FT                   /orf_name="An01g02750"
FT                   /product="Similarity to hypothetical protein CAC28656.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43642.1"
FT                   /db_xref="InterPro:IPR014851"
FT                   /db_xref="UniParc:UPI0000EF9EFC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q819"
FT                   /transl_table=1
FT                   /translation="MFVRIDLLCQESDVLFLFRFNHTPSSLNHSSPWMHVEDNTHLTLQ
FT                   CLSLSLSPLKAFLKEVRTYPRKVSESTISIYRTQSTPRDIHWMPVATRLPRDISTIILN
FT                   ENKKQKILQDITEYLHPQGRQRWRSRRSGEAEDRRREGETAGACGRGFLLQYKREPEKA
FT                   CENVAGWVEEDLGVDDEQTTNTEEDRDK"
FT   CDS_pept        complement(650688..651305)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217149" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806677"
FT                   /orf_name="An01g02760"
FT                   /product="Similarity to killer toxin Khr -Saccharomyces
FT                   cerevisiae"
FT                   /protein_id="CAK43643.1"
FT                   /db_xref="UniParc:UPI0000EF9EFD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q820"
FT                   /transl_table=1
FT                   /translation="MVKLSKVLCGVLACGFIDPCLAGDNETAYDVITTPIVADWDDGAG
FT                   NMTVKLKVINADYAWQWANVTSDTTDLEKRTGITIQKVVTTAKVASHVIFTVKAGLEIW
FT                   EFLAGLIKSKSDADSCTLTYGTDVSGEKVLGYAYKATTTGSNCDTTAEKKTILAAVEKC
FT                   VTTLHNSGTTVGCCEFSHGGTWRGHLRLSAEPSVYPVHAVDC"
FT   mat_peptide     complement(650691..651239)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q820 "
FT   sig_peptide     complement(651240..651305)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q820 "
FT   CDS_pept        join(complement(651935..652027),complement(651728..651795),
FT                   complement(651554..651651),complement(651423..651463))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876801"
FT                   /orf_name="An01g02770"
FT                   /product="Similarity"
FT                   /protein_id="CAK43644.1"
FT                   /db_xref="UniParc:UPI0000EF9EFE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q821"
FT                   /transl_table=1
FT                   /translation="MSSFRIGNEGRAFRTVGSLKWDFVSLQFSAQQNRLIWPFLWWWRV
FT                   LPPLIYSRCVNQIPQEPLIYTSGDWKLSSEYWQGLCPPGCKALIPRYGSVQLVP"
FT   CDS_pept        join(complement(653789..656634),complement(652747..653713))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211756" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876802"
FT                   /orf_name="An01g02790"
FT                   /protein_id="CAK43645.1"
FT                   /db_xref="HOGENOM:HBG329840"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI0000EF9EFF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q822"
FT                   /transl_table=1
FT                   /translation="MLERAAGCLENAGRRFFRDPNGAVRGRGSIYSTLGQFSSAGAELL
FT                   VFLQATQRSASNTSTATSTTGRTATDPRAPVLDFLYPPRTQEFIATCLIRSPRRLVPRR
FT                   KRKAVPGLSRNYSSEAVSLDRRVDAEAHMLDDSAEIIADEDRAIAKNELRALLDKEEIE
FT                   DSDKLWSLFSKAGHPLDLTSALLAGIGSSERDVDSRRARRLLNSLPTESRTSEDYLHMT
FT                   KSCIATGNFSDVIGICREAVSCGRGVSCWAYCFAQFVNSERWDYVQDIWRSRPLGDNSL
FT                   WHAVAPWLQLSSVHKPLFALADYLQDQSLHSPVRHATRFILNNVFSSTEFAEATATETL
FT                   LALLQKFNHLDMVTSRNYFDLINILQESEHRSTFVRSIVVYRNFRWQMEEETPPRKLLA
FT                   KLLKRLASFEITTGILYFLDEISQFHRKPTEDVYRQALIVFSRAGDVDNVQHVFERFLS
FT                   DHGKPRSRKLVAPLLYVYARIGDVEKTTRQFRRISEEFNLQPNIICWNILLTAYSKAGD
FT                   LSGTFAMFKKMIEEGVEPSSHTFGIMMGLCANRGDVTHVRDLLSLAQQHNVQITAPMID
FT                   TVVEAYCNNSEWEMAEHVAETCLGLDVKGSRVRMWNILLWNYAFRMDLEAISRIRSRMD
FT                   AAGLEPDDMTYSALMLSLVLIGQTDSARRILRALHRGRRVYATEFHYAVILYGYLKDRN
FT                   RDMVHIIFREIKDRFNQPGLGSRLLVLKSQIQRDLQLLAQGGQVGNHANIRLENSEKFL
FT                   AETLADYHSTKLATKYPLLGSGRMSARKGFPAVYYEYMISAYGMKGAYLSARRLFDDYT
FT                   ASHAPKDSDEENYHDIAPLRLLSALMLAHLKAEQYHQVEECWNLAFTRALKIASPTSPD
FT                   IDEWLSRQLNPVTPPLPSHAELVVNPDSSQATSSEPATTKKDPILPAYRFMLSRPLSLY
FT                   LRSLAYGNEVSKISEVIAKLSDQIEAFTVFEHKFMPNFPGWDNLRRGYGARPPGVPSTI
FT                   DAMENPKRAKPPNVLGKLGRRYWSKIQPDFMQPTYVSMVYLAAALRRLRERSIHEGGTD
FT                   LQAIYDAAPKTIAAVARLPYLREKFQGVLLRRRQEKGEMVDELGRDRYVWTGGILGVGG
FT                   LTRSKSRVEPTGDKAEQDSSNVRVESKDASSNPIDEPPLNVGISELDDDEQDSDVAPSP
FT                   FRKTLDYPDEYDMEAETLLEERGKELGTKEELMDDESLVEDDEDEFDDLEEDLEMEEEE
FT                   EKEEEEEDWIAEEAEEGEDTPDAAEQDIYDPQDEGQIPQGEGETR"
FT   CDS_pept        join(657121..657311,657405..658547,658603..659110)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806678"
FT                   /orf_name="An01g02800"
FT                   /protein_id="CAK43646.1"
FT                   /db_xref="HOGENOM:HBG329841"
FT                   /db_xref="UniParc:UPI0000EF9F00"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q823"
FT                   /transl_table=1
FT                   /translation="MEITDFIFSQREESLLTGNYNAYRAHTTRKLHSARLRLGQTTPKR
FT                   SKYIAKRPVTAEDVNSNVEYVHTLLISAERAWANAMHMKTTHSADPSAKGVSGTTRGHI
FT                   ISKLRKAVTFAKQLVHVLEDQETSGAADTDVLEARAYLASLLGAYFLEKRNWEQCLQNY
FT                   SVSRVIYAALGQQVKKDAFRDLLSGTVDPSIRYAAYQLKLPRSKPIPSLALSYFPSDAT
FT                   IRSEVEKLDPNCLKEDAAGTRRTADGEVQQLPGSVTWRSHTVGLEDAAISQALASAAAA
FT                   ESRLTTWLAEGEGKNASSKDKAAAYDNVIIASQDAVDATKTAIDDLAGEGVDPSDKRMQ
FT                   ALQITRTAVNYDLVGWRIGRNRVLCGDNDGVSFESVSTKLPKSAKATAKQDDATGKKLA
FT                   RLRERVVLYDSTLQSIEFILELPGVAADTAFVRELDAKRRYFRALRCLTIGRSHGILGK
FT                   STNALALFAQALALVTETARSPQSLTETEGPPRLDISRSQVQTLELTLKGLVAQYRGLV
FT                   TLEKMSAEAQSKSVTQRPAVERLHDFAGDALDLTNIVPYPPQMQPIPVKPLFLDVAWNY
FT                   IEYPRQSTPAADNSQAQPEPQPEEKKGGRRGWFGFGR"
FT   CDS_pept        join(661184..661343,661416..661566,661652..662900,
FT                   662953..662988)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876803"
FT                   /orf_name="An01g02810"
FT                   /product="Cofactor: Heme."
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43647.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG592092"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EF9F01"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q824"
FT                   /transl_table=1
FT                   /translation="MASVNGSFVSPSADAVVSPRLFEPTGLVASVLEGFTVWKALLTLF
FT                   VAAVIYDQFRYLWLKGSIVGPAWKLPFMGPFLQSVNPKFHEYKAKWDSGELSCVSVFHK
FT                   FVVIASTRDMSRKIFNSPTYVKPCVVDVAHKLLGADNWVFLDGKDHVEFRKGLNGLFTR
FT                   QALSFYLPRMEEVYNEYYARFLRISKENNFKPTPWMPEFRELMCAVSCRTFVGHYITEE
FT                   AIQKIADDYYMITAALELVNFPFILPYTKAWYGKKAADMVLAEFSNCAAKSKARMAAGG
FT                   EISCIMDAWVKAQQDSAKYREKIAQGIAVEASDKPAQVLRDFTDYEIAQTVFTFLFASQ
FT                   DATSAASTWLFQLMADRPDVLDKVREENLSVRNGDIKAPLTMELLDQLPYTRAVVKETL
FT                   RYRPPVIMVPYLVKKDFPITENVTVSKGSMIIPSVWPACHDEEAYPNADSFDPDRWITG
FT                   TAEQQTKNWLVFGTGPHYCLGQTYAQLNLMAMIGKASMEMDWEHTPTPESEDIKVFATI
FT                   FPQDDCLLAFRPRP"
FT   CDS_pept        join(665173..665272,665452..665661,665745..665779,
FT                   665860..665901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806679"
FT                   /orf_name="An01g02820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43648.1"
FT                   /db_xref="UniParc:UPI0000EF9F02"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q825"
FT                   /transl_table=1
FT                   /translation="MVEAYGNLHSRIISDCAVSCFHDQVVVICSSPLSHFLETLGHATS
FT                   HTVGTYNGLLEVQVTRDRETGKLITTCEHRVLGSSQGTLFTSKIDLGALLYDRVGETHD
FT                   SVAIPGPAEIAQSADLAFEIIGSW"
FT   CDS_pept        join(666258..666545,666601..666978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876804"
FT                   /orf_name="An01g02830"
FT                   /product="Similarity to heat shock protein 67B2 -Drosophila
FT                   melanogaster"
FT                   /biological_process="response to stress"
FT                   /protein_id="CAK43649.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG329843"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI0000EF9F03"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q826"
FT                   /transl_table=1
FT                   /translation="MASLLPLRRAPTSLLSSTSKQSTLLVRSLRASTTIPSTRTFTTRS
FT                   STLLPNTITKRTTITPISRPHHHLLISSTSIRQKSTKDNDAPTFRQWGFEDINASLPNS
FT                   PTEKPIILIDVREPAELSSTGIIPSAVSVPLASQPDALFLTPEEFETRFGFPKPGVKGD
FT                   EEGAEIVFYCKAGVRARAAAQLAEQAGYEASRLGVYDGSWLDWAKKGGRVERWEGNDN"
FT   CDS_pept        join(complement(670490..670948),complement(667930..670412),
FT                   complement(667632..667875))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000105770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110821"
FT                   /orf_name="An01g02840"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAK43650.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG635083"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI0000EF9F04"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q827"
FT                   /transl_table=1
FT                   /translation="MAPKKKGNKRQEEDWEAELGESAPAAGGEAEAPAAEEGAPADEDA
FT                   GMGGGGLLAALRKNKNKKAKKGKPVNDFVEGEDATQEANGDADFASKQPEEGTFDEDDV
FT                   FAGKAKPKKAAAAPEPKPAEEEEGGFRVKSKKEKEREKKEREKQRKREQAAKKKTAAPA
FT                   EKAQPAKAEPEKKAEAAPAPAAAPVPETGGKKKKIPAHLLAIQKQQEALRQQREEEERL
FT                   LAEAQAAEEERRRIEEEEEKKREEARQRKKEKEKEKKEQLRKEGKLLTKAQREAKERNE
FT                   RRMQQMLAAGVGKVAGLEEGQAEKKRPVYENRKKRGPKKQEDDLEAAAARAKAQREAEE
FT                   ERRRKEEEEKKAKAEAEAAAAAGGEESELDDWEKAADAEEVKDSWDAPSDEEEEKPATN
FT                   GKAAEKPASKEDEEDESEDDSDETSDEDSEDEEQSAAQKAIAQRKAEAAERRKKQHEEA
FT                   MAARSKDNLRSPICCILGHVDTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPVDALR
FT                   QKTAVVNKDGQFEFKIPGLLIIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEPQTL
FT                   ESMRLLRDRRTPFIVALNKIDRLYGWKKIDNNGFQESLALQNKGVQNEFRTRLERTKLL
FT                   FAEQGFNSELFYENKSMARNVSLVPTSAHTGEGIPDMLKLLTTLTQERMTNSLMYLSEV
FT                   ECTVLEVKVIEGLGTTIDVVLSNGILREGDRIVLCGLNGPISTNIRALLTPAPLKELRL
FT                   KSQYVHNKEVKAALGVKIAANDLEQAIAGSRLMVVGPDDDEEDIEEEVMSDLENLLSKV
FT                   SRDQRGVSVQASTLGSLEALLEFLRVSKIPVANISIGPVYKRDVMMAGTMLEKAKEYAV
FT                   MLCFDVKVDKEAAAYADEVGVKIFTADIIYHLFDDFTKHMAELTERRKEESKMLAVFPC
FT                   VLKTVAVFNKKDPIVIGVDVAEGSLRLHTPVAAVKANPETGAKEIIDLGRVVSIERDHK
FT                   PIQVCKRGQPSVAVKIEGSNQPMYGRQLEDKDTLYSHISRASIDTLKEFYRSDVSMEEW
FT                   GLVKKLKPVFDIP"
FT   CDS_pept        join(complement(675083..675639),complement(674914..675028),
FT                   complement(673300..674854),complement(673070..673236),
FT                   complement(671577..673019))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211723" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959930"
FT                   /orf_name="An01g02850"
FT                   /product="Putative uncharacterized protein "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43651.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG323874"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI0000EF9F27"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q828"
FT                   /transl_table=1
FT                   /translation="MATSGSGAGLAVTTSATGDSMDIETENIYSASQAKIGLLSHTLVS
FT                   SPIIQWILPAHLRSKDQNDVVFVGERHLQIKEAVSGVHLEEVTTKSDFDSCIMAAKVVN
FT                   VSTELPWEEEMKLGASNSTLRANSDLRQDLPPQILVLSLASKELVFLYFSNASGHFVYH
FT                   RRPLPNDVSAFERFGRNIAVEPRSRAVAVSASSDYFGIFVLKRPPVIQAQMTQNRLDPI
FT                   AEERFFRVEGDIIAMEFLYPKSEDGDKITLLLLVAQDQLTQAVCYEWDANESLRQATPR
FT                   VTKKVLPLEDRLPTMLIPLTKTSSFMLVTTTSITVYQNKLDPQRLPSRYPLPVYEKESQ
FT                   KSPLWTRWARPLRNWLYNQKHDDIYLCREDGEITYLGIGTDGELENQAHLGQLCCDVDA
FT                   AFDILDIGYEGGDLLLAAGTTGDGGLFVQKARDHPRCVQKFMNWTPVTDSVVVKSEDTT
FT                   PSDIASDRLFVCSASSFSRGAVVELRHGVEAQIGLIVALEELSGTRDIWTMPDGSTGGV
FT                   FVLTSDPMSSLLLYLPADFGEELCAIDEAESGLDSSTQTLAAGCTVSGAIIQVTDRTVC
FT                   VGATPEMPGYRSEVGPGQTIVVAAVDGPASLIAAVVRTQDEVRLHFKKLTSDGQHQLLD
FT                   VATPSLIQHEPICMIMENLDSSLFLFVGTSNGRILVYRLSESISFLLEATVNVENENDI
FT                   SRAIDSIAIIKNAGEESLKMCTVLCGLRSGILVPFGLLLDRESIDSPIALTQVAPQHLG
FT                   HTSVKVQGKGEFALLTCGQGFWQASCTGRLADYSLQRIWVTDQNNPAYHPKSIHSFSIS
FT                   SSGSQDMDGFSNTLFCVADGQLMICTLEQGTKTVPRRIDLPGSASRLAYSRYLKSLIVV
FT                   YSQTEYDTDADPIKRYTRPFIEFIDPDMQNSLIDSLENPLEDDPRPWRPQGAAGEKISC
FT                   ILEWTPRKGDEEYHFIVIGTSRKHQQERGRVIFLQAYRDPSKPSRIECSVKYIHKFEGP
FT                   VFAIAPYGAFTLMVSTGHEIVPLEPKFSQTRWVRAARYSVLSPAVLITAREPYLYMTTS
FT                   RESLMVLKATEDKLTLHAYDRQKHDGLAHVYIGGKLNLVLCSSRGGRVSLLTENGVTET
FT                   NKMLPTALCEAHLPSSVMRLSSGSDKSPLSTTSQVFYGTAMNGTVYRFLTIGEKEWRLL
FT                   RLLQDLCIRDPMICPFIPKRRRQRNPVGLMDPQPSQMHIDGDVLSRLLIRGPGYLMQML
FT                   SKETLGGPAAPGIRPEQGVPEHFAELTRHALGETSDAVASVMRWLQRILPVDV"
FT   mat_peptide     join(complement(675083..675585),complement(674914..675028),
FT                   complement(673300..674854),complement(673070..673236),
FT                   complement(671580..673019))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q828 "
FT   sig_peptide     complement(675586..675639)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q828 "
FT   CDS_pept        join(676989..677238,677288..677419,677466..678352)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876805"
FT                   /orf_name="An01g02860"
FT                   /product="Similarity to hypothetical protein SPBC651.03c -
FT                   Schizosaccharomyces pombe"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43652.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG329844"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0000EF9F28"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q829"
FT                   /transl_table=1
FT                   /translation="MDQPSENNEPDHITETSLETEQKTAAEAEALESERLKNAELERRR
FT                   AEKEKAIRQACDLRDFDALVSYATSEGGFLNDDVRRTAWPILLQCDRRGPNFDFAGWEQ
FT                   LPAHSDEEQVQLDVNRSFVYYPECSDQELSIKKDELSKLIKQVLRCFPMLCYFQGYHDI
FT                   VQVLLLVLGGQNSAAAVAQISLLRIRDYMLPSLSPALKHLELIPAIIEKADPALRRHLA
FT                   ETKPFFALAATLTMYSHDIQEYSDIARLFDFLLAQEPVVSIYLFAAIILSRKKELLEFS
FT                   VDETDMLHFTLSKLPNPLDLEGLISRAMQLFEAHPPESLPFGAWKRIPECSVLKSSRDL
FT                   VRIQAPDETVGLFAKQVRHLRYEERKEKTVAFLWNHRRTIGSVAVTIFIGAMSFWIKKR
FT                   GFDNTIWSYVSRFHGALQARGYI"
FT   CDS_pept        join(678584..678745,678804..678855,678924..679629,
FT                   679711..679801)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211701" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806680"
FT                   /orf_name="An01g02870"
FT                   /product="Similarity to hypothetical protein SPAC227.06 -
FT                   Schizosaccharomyces pombe"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43653.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG329846"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniParc:UPI0000EF9F29"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q830"
FT                   /transl_table=1
FT                   /translation="MVASAWLSRQPLRCTLAFPHLPGTESSTTTFENERELPKMANQGY
FT                   DVVVDVDAEGDLGHTDLQEDLEFHRSNFENDQRNAKAQQDSAPFLGGGSSRGRDRSPGG
FT                   TPSKLNWWSIHYYSQFFDVDTNEVLRRCVAALYPRSNFLDVLEGNPDLYGPFWIATTVV
FT                   VILFLTGTISQWLSNNDDEHFEYDFTLLSGAAGLVYGYTGIIPIALWGALKWFGSSSAD
FT                   LVESWALYGYSNLVWIAVALVSWSPLTALNWALVGVGFGWTVFFLLRNLYPVLSATDAK
FT                   ASKILLILVIVLHAGFALAIKILFFAHGSPVSKKNKDHDDDDDHDDDKRRMFGGW"
FT   sig_peptide     678584..678661
FT                   /db_xref="UniProtKB/TrEMBL:A2Q830 "
FT   mat_peptide     join(678662..678745,678804..678855,678924..679629,
FT                   679711..679798)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q830 "
FT   CDS_pept        join(complement(681196..681196),complement(681102..681108),
FT                   complement(680798..680978),complement(680452..680562),
FT                   complement(680256..680342))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806681"
FT                   /orf_name="An01g02880"
FT                   /product="Putative frameshift"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK43654.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG713462"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI0000EF9F2A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q831"
FT                   /transl_table=1
FT                   /translation="MQIFVKTLTGKTITLDVESSDTIDNVKTKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLP
FT                   PRATNCRKKKCGHTNQLRPKKKLK"
FT   CDS_pept        join(complement(683414..683416),complement(682953..683197),
FT                   complement(682791..682896),complement(682599..682737),
FT                   complement(682162..682548),complement(681695..682111),
FT                   complement(681549..681579),complement(681408..681489),
FT                   complement(681265..681372))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876806"
FT                   /orf_name="An01g02890"
FT                   /product="Complex: forms a complex with the other RRN
FT                   proteins RRN6 and RRN11"
FT                   /protein_id="CAK43655.1"
FT                   /db_xref="HOGENOM:HBG323875"
FT                   /db_xref="UniParc:UPI0000EF9F2B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q832"
FT                   /transl_table=1
FT                   /translation="MPVVRDLWALRLETYAEKINDPSEQDEEPEFFSSQVTSGLDGAED
FT                   IKFRGRQATWPRLIDSIALCYLGALLMRLPVGVGDFYRMVMRGEVPFIRIVKDIPREMR
FT                   DRLPQEFISILETTRLLQAEHLHGAVSDLLLLYHGKFNMQFPSLNWPVLLYKYVKRLAL
FT                   PLDIYPAAKKLQHLLGFNFEFPTSISGRRRPLQLPELQLVALVVISTKLLFPFDDVERY
FT                   PTNIEEPTVQVIDWSLWSQIQRHFDNRETPAGQLGKGKEILVTERDVFSMTPSQLDEYM
FT                   DWYENNWLDASKVSNPLAELFPTGPSAGESQATAPTPELTDEEALDELVKASTSQLRAR
FT                   QVIAKDDLDTPRPGCSYTRYRTESDLPDTARAFYETAAKVVGVSISTLIRAVSQAENQI
FT                   NRWLEEQRRVEYFGSMGMEFSQESSTDSDNDEEKTSEIVSHIWSSVRSSIMKAQSQHGP
FT                   RTTDHGPRTASNLGYGLWRLRRGPERGRTALNPDHVRSVPPLLSEKS"
FT   CDS_pept        join(complement(685162..685173),complement(684670..684936),
FT                   complement(684479..684611),complement(684340..684410))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110822"
FT                   /orf_name="An01g02900"
FT                   /product="Function: Translation intitiation factor eIF-5A "
FT                   /function="ribosome binding"
FT                   /function="translation elongation factor activity "
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /biological_process="positive regulation of translational
FT                   elongation"
FT                   /biological_process="positive regulation of translational
FT                   termination"
FT                   /biological_process="translational frameshifting "
FT                   /protein_id="CAK43656.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0006452"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="GO:0045901"
FT                   /db_xref="GO:0045905"
FT                   /db_xref="HOGENOM:HBG526951"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="UniParc:UPI0000EF9F2C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q833"
FT                   /transl_table=1
FT                   /translation="MADEHHETFESADAGASATFPMQCSALRKNGHVVIKGRPCKIVEM
FT                   STSKTGKHGHAKVHIVAIDIFTGKKLEDLSPSTHNMDVPNVYRKEYQLLDVTDDDFLSL
FT                   MDENGNTKDDVKVPEGEVGDRIRRMFHDEEKDCNVTILSSMGEQVCMDVKEAPKGN"
FT   CDS_pept        join(685681..686547,686600..686894,686949..687769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211679" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959931"
FT                   /orf_name="An01g02910"
FT                   /product="Similarity to hypothetical ARE1-like protein
FT                   F3I17.5 - Arabidopsis thaliana"
FT                   /protein_id="CAK43657.1"
FT                   /db_xref="HOGENOM:HBG323876"
FT                   /db_xref="InterPro:IPR007258"
FT                   /db_xref="UniParc:UPI0000EF9F2D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q834"
FT                   /transl_table=1
FT                   /translation="MWLDRISGHATPSGPQFDSRSSSPLPRRTSSRLAPTPQNNRPASS
FT                   RQGSALSLLSTPNDSSTSLSAPARGEGSSPKPSATRPRPSDVADPLEVLNGIIGKQGKT
FT                   RDSSPASVAELKPPELVEDIDFHGLSLEDFIAEEDQPRRAWQSDVGAQTIQQFEKERDK
FT                   FQDLHSAITGCDDVSKSVEMYLNDFQNELGAVSAEIESLQSRSIQLNAMLENRRNVEQL
FT                   LGPAVEEISLSPKTVRLVAEGPIDENWVKALNEIETRTASIEAKASGTNSSKSIEDVRP
FT                   LLGDIKKKAVERIRDYLVSQIRALRSPNINAQIIQQQRLVKFKDLYGYISRAHPTLTGE
FT                   ITQAYINTMRWYYLSHFTRYHQALEKIKVYPSDRNEVLGGDPTSHKTGNIVPGGRAGSA
FT                   AHDPFSLGRRVDILRAGNQMAISSYLAEEDNAFHGLEIPFRNFNLALLDNVSAEYSFMT
FT                   EMFSTLGFQQISRKAVEIFEPVFTLGQTLTKHLIEQTTDALGVLICVRLNQQAAFELQR
FT                   RKVPVADSYVNGTNMQLWPRFQVIMDTQCESLKRVAANTGRSAVSALSLAGGDDLNKSS
FT                   APHFLTQRFGQLLHGILVLSSEAGDDEPVSNSLGRLTTEFDNLLTKLSRIGGDAKRRER
FT                   FLYNNYSLVLAIISVSRSIRRGYWC"
FT   CDS_pept        join(688177..688392,688472..688597,688674..689663)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000245179" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806682"
FT                   /orf_name="An01g02920"
FT                   /product="Similarity to hypothetical protein PA5145 -
FT                   Pseudomonas aeruginosa"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK43658.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG525746"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI0000EF9F2E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q835"
FT                   /transl_table=1
FT                   /translation="MPTPPGVGNNHLSASPHPNNAPPYNAGIVTTIPLSHPVSMATRIL
FT                   RSLPNSRLLSRRAFSSTAASKADVTHAVIGAGVVGLAVARQLAMKEGTSTILLERHEAP
FT                   GTETSSRNSEVIHAGLYYGTDTLKTTLCIKGKELLYALCAQHNIPHRNTKKWIVAQTPE
FT                   QWEACLRVHEHAKRIGVPTRILGQDEARRREPEVRALAGIVESPTTGIIDSHSLMTYLQ
FT                   GDFEDRGGDCAFMTKVTGIEPVAASEGGGYRISAVSADGSETTITAETVINSAGNGACA
FT                   INNMVLPAERHRKAYFAKGTYFSYSASTPKTSVLVYPATLPGTGGLGTHLTLDMGGRIR
FT                   FGPDVEWVEDPNDLKPSPTRLQQALPEIRAYLPNVDVEAIDLDYCGIRPKLGKGGAVNT
FT                   GKGFHDFVIQEEEGFPGFVNLLGIESPGLTSCLAIGERVRDILY"
FT   CDS_pept        690505..691287
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654014"
FT                   /orf_name="An01g02930"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g09280 - Aspergillus niger"
FT                   /protein_id="CAK43659.1"
FT                   /db_xref="HOGENOM:HBG329847"
FT                   /db_xref="UniParc:UPI0000EF9F2F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q836"
FT                   /transl_table=1
FT                   /translation="MTTHLQQPHHHNFHPHTSSYNPYHPYTIPNHAQTKKQRSRPHRRQ
FT                   RQHHPSTKPPNPSALKTPSSPSPSKSNRCFTWLLLPPASNTHIAKNRSSFSSYRRAPCK
FT                   IANQRVLGVGTVQLRVQRAPDDPRTNTLVLHDVLHMPNARCNGISVAKYTGESEEETAS
FT                   EGGSSAGERAVVEEVENGGLVKVKSEREDGEGLWFARGRSRGGQGKGEGGDDGLRVVLA
FT                   GEKEMEKDDGAGKGIMGVVASKEELEMLNERVKNRSWV"
FT   CDS_pept        join(complement(694162..694237),complement(694059..694113),
FT                   complement(692920..693991),complement(692751..692873),
FT                   complement(692655..692705),complement(692483..692607),
FT                   complement(691397..692438))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211655" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959932"
FT                   /orf_name="An01g02940"
FT                   /product="Similarity is restricted to the C2H2-type zinc
FT                   finger motif"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43660.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG323877"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EF9F30"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q837"
FT                   /transl_table=1
FT                   /translation="MVLRKCTICDRRFKKTEHFKRHERSHTKEKPYECNVCHKRFSRSD
FT                   VLSRHARGHNQPAANAAVRPGAGLPATPTNQAPADRSSTMTADTQNYVLGIGAESARPL
FT                   QHGSSAPHNSAFSAALDQQSTSLDFLANVSAHQPRTEPIANQVMASEHQEYLGWNDVPV
FT                   PDQQCYRGTMLDPLHNDILQFWLEPQGDSISQQGSIDLGGNSNLGMLGGAVASSESRPS
FT                   IGSMSLSSGGSIPIERFARVQRYWLAPSNNTGRLMNSLWHDIAYSEEDNVFALRPTHSS
FT                   SGPSGYMQGSRYGVDEECRQRLYTIFSQSRGQFQMRSSESTAVSPFTQPPRNNSNFPPA
FT                   EILDMALDLFFRDFHPLVPFIHVPTFSAKDARPSLLYAMCLIGMVLLGTKGTLNFVVNN
FT                   FSSMLESVTADLSKCSVGVEGSLSTVSTFAAAFLFLNLAAMTGEKEHLVKCQMLYVNLI
FT                   SIAQRHGLFAAREGQVLGANLFDAIPNTETRWKAWSKVESVKRLITGLLLLDSWYSSFM
FT                   STSPIIVPDSVQMILPCEEALFRATSSTRWMQLSDSDKVRLMPTILMPSENVDVPTLHS
FT                   PVDDFCMYAVLAMVQSRLSEAYYRLLSNRASYPFAPCNTYAMDGRARCLPSLQLQLTSK
FT                   YGDVLDRLNPNAAVMWHNMCMTLTADTQIFDMAAGRSGPGPARKALDDIAAWSQTPAAR
FT                   RACLHAAHIYRAMTNRRASDHTMFHSVFSLFYAALVLGLYVFMVPNPSEMQRGGNSIEL
FT                   FDDIDWQKVGTEGFTSFMEPRKGQPFPPSEEPALEFIKNGGTVYLRGVPIQGGYQAARR
FT                   ILLDYAGLLKDTGKWSVRKFSYVLHIMSDVLMDVE"
FT   CDS_pept        join(complement(700631..701627),complement(700061..700563),
FT                   complement(699334..699985),complement(698623..699285),
FT                   complement(696265..698561))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234473" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876807"
FT                   /orf_name="An01g02950"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK43661.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG329848"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniParc:UPI0000EF9F31"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q838"
FT                   /transl_table=1
FT                   /translation="MMPTSPSKRDMRAHPHQNRKVPPRHDEYNVGWICVLPIEMAVAKL
FT                   MLDEIHPPLPMPPNDPNTYILGRVGDHNVVIACLPAGTYGSTTSVALERQVSSSFPAIR
FT                   FYLSVGIGGGIPSSKADIRLGDVVVSQPIGKSGGLIRYDLGKVLSWDESSHQVPEFLST
FT                   ALAALQVNHNLSGRMGGHVASYLSDMQEKLPPAAAEKFARPEEDFLFQPEYEHIGFDSC
FT                   ADCDRSKLILRRDREHEEPVIHYGSIASGPQVMKNGQLRDRIGQELGVLCFELEAAGLL
FT                   DNLPCLAIRGISDYADSHKNTAWQGYAAAAAAAYAKELLLVVPALEKKIHTASFSVRAM
FT                   SPSNQARSTDASGYSNPTPGWSRQKESTFNAPPTDSGYASTTHQKVLRGEEYRTEYVHD
FT                   VQSIVSGEERFSSPPAAASPRKAEDYSEDTESIYTARSGISPSDKESYISELVNDLFRK
FT                   VQYDQDAQNLPERIHGILPQLLKAFAMRFGQFGSTQIHRDIMYPDSEIANGLRVKYLED
FT                   QTETHVSRQDDTKMELGDLMDLWDQNLEDADDDLAIPQFDSGAENSDSDEDILIEDDEN
FT                   LPEYATYRKLITGSPVYEWLLRSLRRKLQLHPAEPNVQDAIRDRILKTLPSSRRVSRYD
FT                   QPTVYQVVYLLKWDPVSFIAEQEYDISKEGFLGKIITITGTSQDAQAMTCLQYLHQTWH
FT                   SYGANILQLVEAALVDERGYEHRCTLPDNTQLAAWANEKEFLVEVTGIEGSIAEIGEQL
FT                   AWLGSVLRCSPHDSRISYCTPFVSNTSVEEASIPTSQTPTLTRVSCTIDFKVDDQEQAN
FT                   SPPSLGQCWHDLFRYPTVAMGFPIPYRSREQTGLEIPLNILAGLAQAEQVDIFSDKLFI
FT                   KGFSSLLIPTKYIRDQDQMIWHLRYNVHGDRISYLDGIEAHVGHITLADLESSRHILGW
FT                   CSDAKCYAGTADASYSINRSWLRPPSSRCSLNNTFIAAGRLITGGDPAIYGNKDLPYRL
FT                   IRDEYIEKLSWIARQYVVMWDAGGKRGWLVNGACALLHLLIASLHFNRTGPLGFAFHLT
FT                   PTDIKVPENTITPSSAMEVLLNPDNLCLTLYHAKQSEPNEATLPTVQIKDRVDRLYSML
FT                   EKIMDHQAEIMGTEGAASRKMARGILEGWDFKDLATQEDPLYPRFCKLGTRGKSWVELT
FT                   RDVRAAVLFGTGFGEILRPVDNGQLCPYWSRMPEGKSYLAVSGYDLANIIDRFGNPHSS
FT                   PVRLTRNLIWCNCLGNGPPACKCIGCPEQTVHSELAQVVLPSHFRKRIPKHNAVRPSGW
FT                   SHGAILFGYNRDLRWTWNDTGFPEQEDVLSCSDDDSGSDSDDDFHDSGLGTILAPSATA
FT                   NGPGRLPLSRSPPEGITHEDYEVGIVCALSKELLAVRALFDSPHPDLEKDRNDPNCYCL
FT                   GRMKGFNVVAAGLPHDDYGTNSATNVASHLIRTFPRLKFCLVFGIGGGVPSAARDIRLG
FT                   DVVVGTGVIQGDMGKWIQNSEFKMTAQKQQPPPYLRAVITKIRSNGFISFESASNPLLD
FT                   DLSLIASMKPEYSYPGAGKDMLFDPGDVHVETEPTCDNCIGSRRPRTRQHDGPNVFYGL
FT                   IASGNQLVRDARYRDRLGQENVICVEMEAAGVMRTTTDCLVIRGICDYADSHKNDQWQE
FT                   YAAATAAAYAKFFLSHMREGVHEFAVRVPSRLEAPTGPVHLQKQKRAAPCAEYDQHMVL
FT                   KRSRWQ"
FT   CDS_pept        join(complement(703651..703879),complement(702960..703597),
FT                   complement(702549..702903),complement(702380..702498),
FT                   complement(702178..702327))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000139824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806683"
FT                   /orf_name="An01g02960"
FT                   /product="Catalytic activity: homogentisate + o(2)  "
FT                   /function="homogentisate 1,2-dioxygenase activity "
FT                   /biological_process="L-phenylalanine catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tyrosine metabolic process "
FT                   /protein_id="CAK43662.1"
FT                   /db_xref="GO:0004411"
FT                   /db_xref="GO:0006559"
FT                   /db_xref="GO:0006570"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG293508"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniParc:UPI0000EF9F4F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q839"
FT                   /transl_table=1
FT                   /translation="MTRKPTRDNDPYEYMAGFGNRFQSEVIPGTLPAGQNNPQEPRFGL
FT                   YTEGLTYSAFTAPRNANFSTYMYRVRPAAAHNGYRNDCEHKSDIENCFLTLNPKVTTFA
FT                   GQAEWAPFHLPKEDERLDFVDGLHTLGGSGDPNLREGIALYVFMINADMDHRAYCNADG
FT                   DFLIVAQLGILDLQTEMGMLFLQPGEVCVIPRGVRFTIRLGPEHNVARGYIVEIWGSRW
FT                   ELPDLGPLGGHGLANPRDFLHPVAHIDENLHEDWEIVNKANGQYSVIEQGHSPFDLVAW
FT                   HGNVIPYKYDLTKFASQNATSIDHTDPSVNCVLTAPSKDPVTPLADFLWFGPRWDVASN
FT                   TFRPPYFHRNSATEFLACLYGSGLGRSEEFLPGGGSIEVSHTPHGNFSDDYVHEMRNQV
FT                   NDPRRILENQMTIMVESSRSFLFTEYARTGCGTFKAQGPDPKVWDALPDKFSAYPNIKE
FT                   ILSQVKADKEALKKQLEAYYDDKTLAEMARGQRESLVR"
FT   CDS_pept        complement(704561..705994)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806684"
FT                   /orf_name="An01g02970"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK43663.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG499008"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR003031"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI0000EF9F50"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q840"
FT                   /transl_table=1
FT                   /translation="MSASSFAQLCRITRPRISISPIVSRRYIGSVSAIDSGIFRTLFGT
FT                   EEIRKVFDDEAYIKRCMDAEAALARAQSRCDVIPSQIGEMVTRKLRESKLDMERLRYET
FT                   EIVGYPILPLVRQLSAICGDEAGKYVHWGATTQDIMDLASVLQMKEGLDIVEHHLKKVI
FT                   STLRGLSVKYKDTPMAGRTHLQHALPVTFGYKCAVWLSGFQRHLERLEQLKDRCLLVQF
FT                   GGAAGSMASLGTGDDGLRVRKALAEELGLTDPPITWHVARDGIAEITNFLALMGGSMGK
FT                   LALDIIIMSSNELGEVSEPFVPHRGASSTMPQKRNPISSEVILAASKILRSNAGLVLDG
FT                   MVADFERASGPWHLEWVAIPESFVIAVGALSQTQFALSGLCVHSQKMLENLHSTKGLIV
FT                   AEAVMMGLAPHVGRQQAHDTVYEACRESIEANQSLLECLMKKTEVTSKMSEERLSQLYD
FT                   PVNYLGASTRMVEDVLAVD"
FT   CDS_pept        join(706891..707019,707066..707177,707225..707298,
FT                   707343..707366,707457..707783)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959933"
FT                   /orf_name="An01g02980"
FT                   /product="Similarity to hypothetical protein CG7415 -
FT                   Drosophila melanogaster"
FT                   /function="dipeptidyl-peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK43664.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008239"
FT                   /db_xref="InterPro:IPR005317"
FT                   /db_xref="UniParc:UPI0000EF9F51"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q841"
FT                   /transl_table=1
FT                   /translation="MDLYNTCEGNWEQLATKTGVGILLLDEFLDYAARFLSNIGNYFGS
FT                   GDQKFTPDISGEALNFLASVSSSASKILEQIKPDDIAYNMYLQLGVDGLRGLENYDPTT
FT                   KILEQAHSRDVEKNSLTVKVDRSRVISHGKPSLGRMLLKLHIYRCTADVSNCRRFYENL
FT                   SIVDDEALKWRDILVSKKDPPLVFSQANTYLVGDDVKIKEYEPTAQGVVQSWAERSIE"
FT   CDS_pept        join(708426..708791,708856..708945)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959934"
FT                   /orf_name="An01g02990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43665.1"
FT                   /db_xref="UniParc:UPI0000EF9F52"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q842"
FT                   /transl_table=1
FT                   /translation="MPYYVHLQEHVVDGMLEPIMRKYYLMTAANATAAEKFLVGLQKYA
FT                   RTPNTQMYNAKAVTLEWWNCKVSSAGTIRWIYNEMIAERPENYNYVQELTDCCDTILIS
FT                   DLEAVNWPILPVNQETSQNGLGGYGHVVVGFPILLAVACIENDQNAK"
FT   CDS_pept        join(709725..709986,710055..710249,710313..710699,
FT                   710765..711109,711172..711269,711329..711556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806685"
FT                   /orf_name="An01g03000"
FT                   /function="CoA-transferase activity"
FT                   /biological_process="ketone body catabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAK43666.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008410"
FT                   /db_xref="GO:0046952"
FT                   /db_xref="HOGENOM:HBG353770"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="UniParc:UPI0000EF9F53"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q843"
FT                   /transl_table=1
FT                   /translation="MSRPVPAVFRPIWRRNFSVSTAKRAIDKLCPSAQEAIKDMKGSST
FT                   LLVGGFGFAGVPTTLIDAVRDRPDIKDLTVVSNNAGMPGVGLGQLLESKQISKMIASFI
FT                   GENKVFEKMYLTGDLSLELTPQGTIAEKCAAGAAGVPAFYTPAAYGTIVQSGELPVRYN
FT                   KDGSVAIKNAPKEEREFNGKKYILEESIFGDYALVKVHKADKLGNCQFRKSMNNFNEAM
FT                   AKNAKYTIVEADHIVEVGEIDPESIHLQGIYVNKVIQSTGEKKIEKLTFAKDPNEMLQA
FT                   GSGDATARRERIVKRAAKEFKDGMYVNLGIGMPLIAPSYVEEGVEVVLQAENGILGLGG
FT                   YPKPGEEDPDLINPGKETVTLGRGASVFGSHESFGMIRSGRIDLTMLGALQVSQYGDLA
FT                   NFMLPGKVKGMGGAMDLVSNPEKTKVVVTMEHTDKKGNPKILPECSFPLTGPRCVWKII
FT                   TDLAVFEVSPTEGLTLAEYAEGVTVEEIRSKTAAPFKVSADLKPML"
FT   CDS_pept        complement(711799..712074)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654015"
FT                   /orf_name="An01g03010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43667.1"
FT                   /db_xref="HOGENOM:HBG329852"
FT                   /db_xref="UniParc:UPI0000EF9F54"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q844"
FT                   /transl_table=1
FT                   /translation="MPSKPIASPPLQPKKVHGAVRDDLPVDDYENAWAQQEEEEDEEQK
FT                   ERSGNIAYNAPNVAAARRMNTGTAPNPAEGTHKGTTGSVNRSKTGH"
FT   CDS_pept        join(complement(714315..714344),complement(714201..714281),
FT                   complement(713899..713933),complement(713828..713841),
FT                   complement(713705..713742),complement(712979..713674))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876808"
FT                   /orf_name="An01g03020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43668.1"
FT                   /db_xref="UniParc:UPI0000EF9F55"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q845"
FT                   /transl_table=1
FT                   /translation="MDATTTNAYNSRVIVDPSRTGTGTAHRGSHASAKRSAWLVIPAGF
FT                   GNRSAVGITQSAVRLARTVETCINLIPLSGPAKGYIEALEHRLHETESLLLNLLAQIPD
FT                   SQLSASVQGRQDRSSRHRNSGSPPQTYSSSSSRLGKRGTDYWKRFPLHTVQDIRDWQND
FT                   CLSNDGDGSTRHSSGPEAVKRPSASQSEYQPETVSPKDQMPEFQGYRDMPTLPRIHQIE
FT                   IPNSPIDAGSSPAKVAYGSGFDGEARENRPRMDPVFEAIQYQRARAEAVHEFPGMQKPS
FT                   LWRGAPSVSFQQQFLW"
FT   CDS_pept        join(714732..714981,715033..715871)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000021111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654016"
FT                   /orf_name="An01g03030"
FT                   /function="NAD or NADH binding"
FT                   /function="magnesium ion binding"
FT                   /function="tartrate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43669.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009027"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="UniParc:UPI0000EF9F56"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q846"
FT                   /transl_table=1
FT                   /translation="MTTETTTYRIASIPGDGIGEEVVRATIEVINKLAQTLNTFNIEFT
FT                   HLPWGTEYYKQHGRYVSEGYLDTLRQFDAGLFGSVGHPDVPDHVSLWGLLLALRSPLQL
FT                   YANVRPVRTFPGTKSPLTTAVNGIDWVLVRENSEGEYCGQGGRSHTGQPWEAATEVAIF
FT                   TRVGVERIMRFAFETARSRPRRHLTVVTKSNAMRHGMVLWDEVAEEVAKDFPDVTWDKM
FT                   LVDAMTLRMISKPESLDTIVGTNLHMDILSDLAAGLAGSIGVAPSSNLDPTRKNPSLFE
FT                   PVHGSAFDIMGKGVANPVATFWSAAEMLAWLGEKDAAKKLMDCVEKVCAAGILTPDLGG
FT                   SANTQGVVDAVCKEIEQQLASS"
FT   CDS_pept        join(716367..716436,716501..718178,718301..718796)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217091" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876809"
FT                   /orf_name="An01g03040"
FT                   /product="Similarity: the ORF shows similarity to some
FT                   transcription factors"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43670.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329854"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EF9F57"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q847"
FT                   /transl_table=1
FT                   /translation="MIAGPPRENQYPGIDIHSIRNVDVQSEILDFNANFSSMLSPYPRR
FT                   QHHDPTRMEPPDLTNGPSEIGSLTAHSKDESQFVGSSSGVYFINTVRRAFSESLDPSGS
FT                   SPAQDFPQPEDTLVGSDASHKTSPVALQDDQFPCRWAYDSAVAAVLGNAPPLDTARELM
FT                   MVYFKVWHPLFPFLHGPTFLQAMEGLYSEDRQEPARNEAMADHRHVCWTTIFQCIFNLA
FT                   NSVHPEINLPLESRIESPSSMHSLLGTLTSKHDMLSLQALLACQLYLLARMSLRTASTV
FT                   GGCMLRSMLHAGLHRCPYRYKELTTHDRQLRKRIFWCAYAIDRYLSQALGLPLGVQDSD
FT                   IDVCSPNAPEIHIPGMCNRSHFVRSTSYAEQREHRSQLTSNQHLENTSPHAFSAHSSSS
FT                   AEEAQQNRRELAFASYVESGTLTGRALELFHKSITVRSVPRSSVLFLITDVHKWWNNLS
FT                   IETLQGQQQQPQPQQSSTDQPPSSSPAATTTAAFNFAPFFTVLYQHLILLINRPSLSLS
FT                   PSTPEFCSGLQTCINAAREIISALTTQQESGQSFFWPGFLSAAWMSGLVLAFACQLRQY
FT                   VLSKGAQEITKCLTILHTMSTQWDAAKHCHRALSLLSRTIHENTTTAGDPSSSPNKRRK
FT                   VVVDPHQTTFFTPINSLSTTNLNEEYARGRAGRRTPATATVATTSGLHEPTNTSSHVHL
FT                   SHEDRLFSAEGVSTTNDNNGDAVGEFDFGIVDLLEGSNFDDLADMFGQQYPSF"
FT   CDS_pept        join(complement(719787..721921),complement(719656..719716))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876810"
FT                   /gene_name="pab1"
FT                   /orf_name="An01g03050"
FT                   /product="Polyadenylate-binding protein, cytoplasmic and
FT                   nuclear"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43671.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EF9F58"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q848"
FT                   /transl_table=1
FT                   /translation="MSADVSTTPAAENVNGAAEASPAPAAAAPSATTPEVTAVENSTPA
FT                   PAANQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNN
FT                   TADGERALEDLNYTLIKGKPCRIMWSQRDPALRKTGQGNVFIKNLDSAIDNKALHDTFA
FT                   AFGNILSCKVAQDEFGNSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKD
FT                   RQSKFEEMKANFTNVYIKNLDSEIDDDEFRKMFEKFGEITSATLSRDQEGKSRGFGFVN
FT                   FSTHESAQAAVEEMNDKEIRSQKLYVGRAQKKHEREEELRKQYEAARLEKASKYQGVNL
FT                   YVKNLTDDIDDEKLRELFGPYGTITSAKVMRDTNVERDQSPDSAGKEKEADKENDKEAT
FT                   PEAEKAEKAEEKPSESSEEKDKEAKKSDKKPFGKSKGFGFVCFSSPDEASKAVTEMNQR
FT                   MVNGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFYGPGQQ
FT                   GFIPGGQRGMAFPPQPGMVMGIPGGRPGQYPGPFPGQQGGRGMGPNQQIPPNFAQGIPM
FT                   GMQGPGGIPNGMGYPQMAQVQFGRGAGGRGQVPGMPMGQGMRGGPGYGQGRGAPVQQGQ
FT                   MRPGQGGRGQNAAAPAGPQEGAAGGVNAQTLGAAPPAQQKQMLGEALYPKIQAQQPELA
FT                   GKITGMLLEMDNTELLSLTRKPCAPRSMRPLAFTMST"
FT   CDS_pept        join(complement(724276..727293),complement(723548..724219))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211433" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876811"
FT                   /orf_name="An01g03060"
FT                   /product="Function: pub1"
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43672.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG329855"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000EF9F59"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q849"
FT                   /transl_table=1
FT                   /translation="MFQSFTGNSRRPRQVNLGGRNTNPFAAYPSGRQNPHGAGPQNTLA
FT                   IAQQERLARQQERERLTASRLVQRTWRGYRSRKITRRTWRNEWDTTEKKQGKDHVPSFE
FT                   ILAQQPDVVLQPSLRYGTAADCLSQLRLLVQFLEPWDSGDIARLVYFSEAFQRTLHEVP
FT                   SIATEGEWTTPLKKLASLTLRVLRSVTSPTVPVFAVQRLLQLLVFLTGLIPKHMARLAK
FT                   EYYSVMVILTTDFESISTRYKLSRDSLTESVLALLRPITSETLTAYEWFAKIYLTIPNL
FT                   PEYIGSLDGLANNINYKLLTSALGPLQTLFGDRPKSAEDVDARLWLLAYFIFFHRCALG
FT                   GQTGRPAPEPGFVKVVSELLNSTAVHISRRLESEESNDYDEAPEQTPLHPFIKEQLVSL
FT                   VNQSNITGLLSQLHTTHLSQGELANAQSDASKEAKILATYALTLLRVFPRRGDDIRMWL
FT                   YLGSATSSDQLTGQEGSRIPAIKYFWQASKASRIFAAISQDSTKVLPLLKPAEESQGTR
FT                   SPEISQVERDEEWTIILLFLELYTFVLKVMDDEEFFSSESSFTASSNTRVSWTKESALP
FT                   LKDIKDMTIFLKNLGFTLYWNSADLSEKEATQDTGGIRSYFSSSAAPPDAIASVRDIEM
FT                   KNKEKGLPGVTGIPLDYFKGLVTGLLRMIHERDSRRKFLPDGHWLMTSRFDMEGFIPAV
FT                   VAEEENRHQLQDEDEEEEQDDLMSDAYFEPSPGLIGTGRAQLTRRIEALRRRQQQAARR
FT                   KQLEAVAPRMEILRNMPFFIPFPTRVQIFREFIYRDQMRRRQGYIDPDAWRMSVAQASM
FT                   GRLIDGRPAVQDILSRHHANIRRESIFKDAFDEFYELGDGLKEPIQITFIDKFNTTEAG
FT                   IDGGGVTKEFLTSVTSEAFKSTSDLNLFEENDQHLLYPNPAAVEQRRELLRQLGFVENT
FT                   AEWNENVRDLLRRYEFLGRIIGKCLYEGILVDVNFAPFFLLKWALTGGTGSAQRETAYR
FT                   ANLNDLKDLDQGLYQGLLQLKNYPGDVEDFSLNFTVTDTIPLPDGGNRTTTRDLKSHGS
FT                   DIPVTNQNRLVYISYIARYRLQVQPALQTNAFLQGLGQIIQPSWLSMFNQTELQTLVSG
FT                   DSGDIDVADLRRNTLYGGVYTIGDDKEEHPTVKLFWEVMEKMSNEERQKVLRFVTSTPR
FT                   APLLGFSHLNPRFSIRDSSEDQERLPSTSTCVNLLKLPRYTNANILREKLLYAVNSGAG
FT                   FDLS"
FT   CDS_pept        join(complement(729081..729263),complement(728781..729002))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806686"
FT                   /orf_name="An01g03070"
FT                   /product="Similarity to mitochondrial ribosomal protein
FT                   Yml27 - Saccharomyces cerevisiae"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK43673.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG329857"
FT                   /db_xref="InterPro:IPR019189"
FT                   /db_xref="UniParc:UPI0000EF9F5A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q850"
FT                   /transl_table=1
FT                   /translation="MFKPSQPMLARLRLTTKQVLGGYYKGNRTGSMGYFAKNGSYVIDW
FT                   KKVRTFVVPENLDQFKLTPFVTKRMPPTKSKYTKEVEKRGRIVTLERAFSGKDYLDMWA
FT                   SDNGQEVLEQERLDSEAATEQSSTTQPARQ"
FT   CDS_pept        join(729584..732322,732411..732593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806687"
FT                   /orf_name="An01g03080"
FT                   /product="Similarity to hypothetical coiled-coil protein -
FT                   Schizosaccharomyces pombe"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAK43674.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG329858"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniParc:UPI0000EF9F5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q851"
FT                   /transl_table=1
FT                   /translation="MPRRQTQMRGPKDRDQSLQKSKKPAPKNKKSGNYLNAFAIAESEN
FT                   PGKLGVKRTRLGKEDEPFKRKRHNARDADDSDGPDYSKRRRTGDDEASEMDSNAGSDGE
FT                   GHRWRIGEVGSDDDSELDSDEAMGSSDEERFEGFTFRGSSTMKNKPKQKAPERKKRTRE
FT                   INLSEDAEVSEDEDDLEDDSDDLGEDAIDLTTAWDMNMAEEEEEKAKKAKSKSKQSAES
FT                   DESEEYDSESEDSDSDDNDDELPLSGDDMDEDEVDEHGLSKLQSFVNAMNTEGTTKTAR
FT                   KTGGKQEQGAPTEFGLTSTRKLTIADLLPSITDSRLKSSLKHVDATTTSNTKTSGVPGK
FT                   LDAPLAKRQQDRLDRAAAYEKSKETLDRWLETVKANRRAEHLVFPLPDPEANQTHRMGA
FT                   AEPRTDLESTIQNILQESGLIENNGKSAEEQVQEFEELQARKLPIEEIRARRAELRKRR
FT                   DLLFREEVRAKRIKKIKSKSYRRVHRKERERLEQQERQALLEAGVDLDEEEREKNDRLR
FT                   AEARMGSKHKESKWAKSLKQTGRTAWDEDARRGTQDLALREEELRKRIEGKRVTNGDED
FT                   YLGSSSSESEDEDPWDEEAGSDAEKRKIRQKLSQLEGDDDADTELKGPHAKLLSMKFMQ
FT                   NADAARKAENDAEVRRLNRELHGEESQSEAESEVGRRKFGRKKEEAKTAKESKAKLARN
FT                   EFEEAPGSDDEAQQEADQEVDIVVDRPAKKGPAAPQNKPRGRPQKEIAEEEDAAAVEEN
FT                   PWLVQTNRNNRRAIVNDSQQTVDITLDDANASSGKSKSAPKAQKASAPSKKKVDAEVYG
FT                   SDDEESVPVLLKNHDLVKRAFAGDEVVQDFEQEKFDTIKEEDDQVIDNTLPGWGSWAGD
FT                   GISKKQQKRQKRFLTKVEGVKPEDRKDAKLSRVIINEKRVKKNTKYMATQLPHPFETKQ
FT                   QYERSLRLPIGPEWSTKETFQNATKPRVMIKQGVIKPMEKPMA"
FT   CDS_pept        join(734393..734554,734608..735136,735192..735301,
FT                   735350..737077,737133..737194,737248..737584)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211468" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876812"
FT                   /orf_name="An01g03090"
FT                   /product="Catalytic activity: hydrolysis of 1 "
FT                   /EC_number="3.2.1.39"
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /function="glucan endo-1,3-beta-D-glucosidase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAK43675.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="GO:0042973"
FT                   /db_xref="HOGENOM:HBG398584"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="UniParc:UPI0000EF9D55"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q852"
FT                   /transl_table=1
FT                   /translation="MERKHRWGSSFLLMWLLAAEGVYSAPRRSSSTASPKTQFPPGAET
FT                   ERILPGTNGLYPTSLEREGHPVLPTPTSTGNTKDPWGLDGLLESLGDTADLPNELLSEF
FT                   LPGWGKNYPVTVPVSAYKPASAETTSSATEPQTQPETSDTSTPQAPSQNVPEATTDSSQ
FT                   VSSQASSTTSLTQPSSTTSTTQLSSTTSPTQPTSSASSAQPSSSASLTTTASQTTQADN
FT                   SITSSVVQASVTPMSGQDVFVPLATTPFPQTITARNDHPVPKKGIENVTTPIETNKFYA
FT                   GLFLGSQSNTTFTHPYGLSWAKGSGNAKSYGMAISHNEVNVVANGPTNANIPGNPISYY
FT                   INPIGIQHMILSATELNTSTVLTAENLLPFSADAVLSPTPGSSQRITIPLVQGMGFVTG
FT                   MYNNLQPLIQSGVFFSKVVTASSPRIGIYKYKVSLADGTEWLVYAIPQDGKDPDFRLES
FT                   NTDFRGPSGWSGTVQITKNPAGDSGEKLLDGSSGVFALEAAVSGSVQDNSGTYNLAFAK
FT                   SGKQLQQTPLLMYALPHHVESFDNTTKGRMTSITLRTTTKGNATAVVGETWTMLEPNLP
FT                   TQMGFDPWSVSAGNVNNLSAAAKQVILSVAPTELNQSIDQQSDLNSMYYSGKALSKFAT
FT                   LVYTVNKLGGNPDLAASALQNLKTAFSRFVDNKQQFPLVYDSVWKGVVSSASYGGDSGA
FT                   DFGNTYYNDHHFHYGYFIHAAAIIGSLDSTWLTDSNKAWVNMLVRDAGNSAANDPYFPF
FT                   SRSFDWYHGHSWAKGLFESFDGKDEESTSEDTMFAYALKMWGKTIGDASMEARGNLMLG
FT                   ILRRSLHNYFLMESDNKNQPANFIANKVTGILFENKVDHTTYFGNNLEYIQGIHMLPLL
FT                   PSSPYVRSQNFVREEWNALFSANATDPALNVTGGWKGVLYANLALIDPASSWNFFAQSN
FT                   FDYSWIDGGASRTWYLAFAAGQYIPPTSQSMMLLTTYAGLGGGPA"
FT   sig_peptide     734393..734464
FT                   /db_xref="UniProtKB/TrEMBL:A2Q852 "
FT   mat_peptide     join(734465..734554,734608..735136,735192..735301,
FT                   735350..737077,737133..737194,737248..737581)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q852 "
FT   CDS_pept        join(741159..741539,741617..742467,742534..742606)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000083011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806688"
FT                   /orf_name="An01g03100"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK43676.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG738140"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI0000EF9D56"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q853"
FT                   /transl_table=1
FT                   /translation="MTGLSSENGSTEPDERAALLGDIARSNSGLRPRQQKLHWSHWPRR
FT                   VAHLTWSTLVRDYVNVLLIFVPLGIISGALHWDSTVIFTLNFLAIIPLASLLSFATEEL
FT                   AATMGQALGGLMNATFGNAVELIVSIIALKDNQIRVVQASMLGSILSNILLVLGCCFFV
FT                   GGLKYSQQSFNSTVASTMSSLMTVSSASLIIPATLYASLSGSKDKEQRRDNILILSHGT
FT                   AIILLVLYVMYLYFQLKSHAELFEAANDELNDTENQGGEVEEAEEEEHLLSPWAATVAL
FT                   IVITVLVAICADYLVGSIDSIVTKTGMSRTFIGLVLIPIVGNAAEHVTAVVVAWKGKMD
FT                   LAIGVAIGSSLQIALFVTPFLVILGWIMNVDMTLHFHIFETMAFFISGLVVTFLIQDGK
FT                   SNYLEGGLCLGMYLILAIAFYIYPDDVNEDALFNH"
FT   CDS_pept        join(743281..743628,743747..744079,744152..744570,
FT                   744643..744670,744868..745008)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959935"
FT                   /orf_name="An01g03110"
FT                   /product="Similarity to ribosomal protein of the small
FT                   subunit Rsm7 - Saccharomyces cerevisiae "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK43677.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG323880"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="UniParc:UPI0000EF9D57"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q854"
FT                   /transl_table=1
FT                   /translation="MPPRLNLFTARAVPVLRQSANSSAASRRSFATILNTNRPCAASTG
FT                   HGLKSGLSASVRGQRRCNSSGSDGQDRPKGPTEDPLPHVSEEAAEVSKIMDKKCDGTPA
FT                   SPELEQGSPISEILQRDKEALKHMPKVMQDQMKRPSGSRSFSTSARRLQPELQGKELDD
FT                   ASASVVANMISQVNQQATELHPGLKFEAPQNLPKTENFRKRYETIVEQFTKLLMQDGKL
FT                   SKAQNTMAFILDHLRTAPPPNINPRRRLLPGPPAPQLPLNPVLYLTLIVDSVAPLLKLR
FT                   QQKGIVGGGVSVQVPSPLALRQRRRTAIKWIIDASDKRRDAIFGQRVANELVAVAEGRS
FT                   GVWDKREQVHKLGVAGRSNLGLVARRRAFGYIVPMMCEVDATNEVLDSGHEPMTRAMTN
FT                   SASRGWVPLQSRPILAPRKAAYL"
FT   CDS_pept        join(745747..745829,745988..747251,747310..748429,
FT                   748493..748634,748769..748805)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211490" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654017"
FT                   /orf_name="An01g03120"
FT                   /function="transporter activity"
FT                   /biological_process="sodium ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43678.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006814"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329859"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="UniParc:UPI0000EF9D58"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q855"
FT                   /transl_table=1
FT                   /translation="MKFSHSIQFNAVPDWSAYYLAYSNLKKLIYSLEQEVHHRSAGHEH
FT                   ADVEQAPLLDGGSLNTDAIFRRALDAELEKICSFYQSKEAEIFTEVEDVLRDAEEYAHR
FT                   ADTMNVDPMSDAMIKGRTASSSSRQRPGSIVRRVPSNQERRHSAFSETLADDDDDDADS
FT                   DDEPGTLSNQYRPQSHGAESSNPDGSRTDDMRDSVLWGADSRLLGYSGPSAHRGGAPDE
FT                   HFSDPIVVDLYNAGLSLKKRAVAAYVSICGLKSYIQLNKTGFSKALKKYDKILDRNLRR
FT                   EYVNSVVSLTYPFKDSTMEKVDDNIRKVEEVYANVVTTGNIPLAKRELRLHLREHVVWE
FT                   RNTVWREMIGIERKAQAANVGIRRTLLGGDEDPSKARRQGDEQEVMPKMIRTPFGTIRI
FT                   PQWLCSLSLVTLVLILLVFGILLSVPIMEKPEQQNCLAMLVFVSLLWATEVIPLFVTSL
FT                   LIPFLVVMLRIMLSDNKPHERLGPKEATAAAFSAMWTPVIMLLLGGFTIAAALSKYDIA
FT                   RRMAMFVLSKAGSNPNILLLTNMFVSMFLSMWISNVASPVLCYSIIQPLLRNLEPDSSF
FT                   AKSLVLGIALAANVGGAASPIASPQNIIALQNIYPSMSWGTWFFISLPVCILSIVAIWM
FT                   LLVLTFKPGRETAVAIRPLKDKFTGVQWFISIVTLSTIALWCGSHQLEHIFGDMGVIAI
FT                   IPMVLFFGTGILNKEDFNNFLWTIIILAAGGLCLGKAVTSSGLLHTLANAIRMRVEHLS
FT                   LYGVLLVFSALILVIATFISHTVAALIMLPLVRQIGLGMDDPHPNLLVMASALMCSVAM
FT                   ALPTSGFPNMTAIMTEVPQTGQRYLQVRHFFTRGIPASLMSFAVIVTVGYGLMYIAGLH
FT                   AARSGPGMLL"
FT   CDS_pept        join(complement(749665..750443),complement(749507..749513))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959936"
FT                   /orf_name="An01g03130"
FT                   /product="Remark: Protein is rich in proline "
FT                   /protein_id="CAK43679.1"
FT                   /db_xref="UniParc:UPI0000EF9D59"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q856"
FT                   /transl_table=1
FT                   /translation="MSDQSKQPESSTNNPSQEGENNNNNTTSSPSSPQQENPPTGDQEG
FT                   QEQKPEDTNDTTEDKPKEEEKEEDKQEDEDPQPKQEEQEQEPEPEKEPQPKQEPQEQED
FT                   KAPKQEPQSSDEEPEPEPEQRAPQPSQDRKRRSRPPQKLRQRDDYSDMDNNQQVDRPRR
FT                   QRRQRPQQQQQGQDGGPLGGLPGVGQAGDLVQNTAGNALNGVTGSAGKAVGGILGGGGG
FT                   GEEKEGKDEQLRLRLDLNLDIEVQLKAKIHGDLTLGLLN"
FT   CDS_pept        join(752058..752551,753321..753350,753796..753844,
FT                   753963..753997,754028..754097,754451..754501,7
FT                   54550..754591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110823"
FT                   /orf_name="An01g03140"
FT                   /product="Remark: unspecific blast hits are due to the low
FT                   complexity sequence of the ORF"
FT                   /protein_id="CAK43680.1"
FT                   /db_xref="UniParc:UPI0000EF9D5A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q857"
FT                   /transl_table=1
FT                   /translation="MATAQAEKPATKTFANDPDDVSDYDSEDDYSDDDTQQKPQQQQQQ
FT                   QQQQRRRRRPQQQNPNDEDDTYYSDEYSDDYDDYDDEDDDYYDDEEEEVQAMERYQPTT
FT                   ISSRDNVPAQPIANGGMQEAEGKTGDDWEDQDGMKLKLELNLDIEVELKAHIHGDLTLS
FT                   LLVSTFGFYLIFSCLAYKKRYLWTLTNSTLSTTSPLFIRYNPVIGRNSQMVSWYCEVVV
FT                   KRFFTSNIFGEGGYSLAIRYTLVACSSSTHIREP"
FT   CDS_pept        join(755202..755293,755348..756155)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959937"
FT                   /orf_name="An01g03150"
FT                   /product="Similarity to hypothetical protein EAA66565.1 -
FT                   Aspergillus nidula"
FT                   /protein_id="CAK43681.1"
FT                   /db_xref="HOGENOM:HBG329862"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="UniParc:UPI0000EF9D5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q858"
FT                   /transl_table=1
FT                   /translation="MQNDNNIVETEGAGNFTCGLNIGGAPVPREGSPQTATTQSPNPAQ
FT                   PAASICESTYIKREIPLDKRTRKERQEKKQNEAKMAPDRSNISFTITHMNANHQDSLAA
FT                   YLQVYCHVSAREAKSARLEDITLSDLVISANGTRYTVPIDPAMGSFSESRSRLVAMHQE
FT                   CLARLGRSDITIKEYRRPEGIEIFLFFVFATALVAFSRRSNFLPGSLFYETVGLGAVPP
FT                   LAQLFYKTQPFVLTVMAGSHVVEASLFTVKRLKRHGVPVLSLVWCAWVVSNLIEGYTVW
FT                   RRFDWVVRQEGAKREHGK"
FT   CDS_pept        join(756995..757068,757152..757680)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654018"
FT                   /orf_name="An01g03160"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK43682.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG745393"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniParc:UPI0000EF9D5C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q859"
FT                   /transl_table=1
FT                   /translation="MGISRDSRHKRSATGAKRATYRKKRAFEKGRQPSNTRIGTKRIHL
FT                   VRTRGGNQKFRALRLESGNFSWGSEGISRKTRVIVVAYHPSNNELVRTNTLTKSAVVQI
FT                   DAAPFRQWYEAHYGQPIGRRRQQKTETTEEKKSNSVVKKQAARFAEQGKVESAVERQFE
FT                   SGRLYAVVSSRPGQSGRVDGYILEGEELAFYQRAIRK"
FT   CDS_pept        758131..759162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876813"
FT                   /orf_name="An01g03170"
FT                   /product="Similarity to hypothetical protein CG16717 -
FT                   Drosophila melanogaster"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK43683.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG329865"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0000EF9D5D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q860"
FT                   /transl_table=1
FT                   /translation="MAPPTTSPPKTIKTSLLLLSDTHTLTPLPPIHPNTSTPFRHPLPA
FT                   TDLLIHAGDLTKVGHKHEHLTTLSFLKSARAPIKLIIPGNHDITLDEPYYKKIGHYRHR
FT                   YRTDHTAPSATSGSDNVSAGKGTPGMALSDDELREIKELYTGKEAWDAGIRYLEEGTHV
FT                   FRLQNGAVLRVYASPWTPEFCQWGFGYPRQVDRYNPPEEEGEGEEGAENPVPDYPGVDV
FT                   MITHGPPYGVLDQVVPNHMSVGCEHLYRAVKRARPRVHVFGHIHEGYGATRREWSSGNE
FT                   SVIQCDKERTLEERCARVDVSKEGGNGLRVGEETLFVNASVVTVQYQAINAPWVVEVDL
FT                   PVE"
FT   CDS_pept        complement(759634..765984)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877839"
FT                   /orf_name="An01g03180"
FT                   /function="GTP binding"
FT                   /function="GTPase binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /protein_id="CAK43684.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0051020"
FT                   /db_xref="HOGENOM:HBG329866"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="UniParc:UPI0000EF9D5E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q861"
FT                   /transl_table=1
FT                   /translation="MPWRPLPRIAFAVAIYPFQPTTPADLPLELGDELYIIEQGGANGE
FT                   WCRGYLVAPPSLLAGLTSSKGQTLEARVFSGIFPRNCVEIREVLGDGEKTITNGDRSSV
FT                   AFTAVPEGDVRHSMASFQDDDHAFGEVSSVVIAKKGKPSQIFIQRLDEDGRGSPASPRS
FT                   PQNFLRTNSTPLAPINVAPRDPDAPKPAAPVPMLKIGDETPTSLSEPLVDEIASCLREW
FT                   HSTNLHQLLLSRQYVTVEEMTKIVEELDFARRQLLYNVLTAQEKDALRQEVVWKLVRGN
FT                   KALGGEIIVRDPQQRGRLLTGEDSAVELARLQSEMSMLDSSPMQQSDAAALHHLMLEVN
FT                   AVSGHAPGPVTLAVYLCSQSETGALTPLSETYVLDIPSPEKFASMGQSAKLKTLFTDLS
FT                   STDIGDNAANGPRLYMVVMVRAPETTSVVSAAAQPRTSISRDSSSGTKQQNGINQSVKG
FT                   SLRTRRSMMWTSKPRGIQSPEQGKEPSKAAPPSSGSNASAKEKASSQPVKESTQLRTVG
FT                   VGFLEISQILRQEKDAEQVINIWSPSEDSEDKEGRDDGFDGVVRTLLPSPTGKYVRSQR
FT                   AARLHFHLYPYVDPDADSLVRKNPTSLHNVVQTKRMGFSQAPTKPRSDIYVTICHATFP
FT                   PEALLSHPQSGQVPVPGHTGLHNLQLTLEVRTSSGARVDRCVFSASNHAAQTAWRTTVA
FT                   DRGAPWNQTIRLNIPTDQIPGSHLIMSIADAPEFPFALAWMPLWDNQAFMRDGPHSLLL
FT                   HAYDKCTSNIENGKGAYLSLPWSSLGKNESAKDEAITGPLATLRLDTHLCSTEYSQDQV
FT                   ILSLLNWRERPVNEVLDTLKRVLFVPEIEIVKQLSSVLDSLFGILVENAGNEEYEDLIF
FT                   NDLVTVLGIVHDRRFNLGPLVDHYADNQFNFPFATPCLVRSYLRLLQASSDAQQSRNLR
FT                   ATFKVGRHVLKFIINARLQQKAKEEGIGITRVQSTFNRDLHTIFKSLEALMKNPSPAMV
FT                   GNKTLVVQHFHTWLPELSKVLSRDETIMIALSFIDSCKDVTGMLILYKLVLIQHYTRLE
FT                   IFGSGSERKSLVSSCISWLAPYWGATGSVSDLYRDQVRLCCAIVAELLKQPDPYLYEFV
FT                   PKIVSSYYSIIPDGVEETTYLSLLFSKSFPFQVKSSKHSQKFDEALVELSAVLAGAATI
FT                   PNPKRPRLKGLELSSFLTQAFEVHNSILNCEAYPESWFSVHVYNHRATVKSLEYLATIL
FT                   TNKFLPSPDDAETFDTRLWETFFMTLLKVVSSDALALETYPEQKRRAIWKIAGDVREQG
FT                   ADLLHSSWESIGWETTDEEREHYGLSKLGGYQVQYVPGLVAPIIELCLSVHEGLRHVAV
FT                   DILRTMILSEWGLNQDLSIIETEVISSLDNLFKRKNMSESVVQKLFIAELSDHFEDSAD
FT                   YDEDLSSAVKALIATVDELLDLFVASQGGSMAESLHTLRLMKYMKDMGREDIFIRYVHE
FT                   LAQVQAEAGNFTEAGLALQFHADLYDWDPKRTLPELLNPAFPEQTSFERKEALYFTIIQ
FT                   HFEDGKAWAHALVCYKELAQQYEDIVVDFAKLSRAHASMAKIYDLISKESKQFPRYFRV
FT                   QYKGLGFPTTLRDKQFIIECAPTERMVSFIDRMQREHPAAQVVSSGEVHDYEGQYLHIN
FT                   PVSVHRDVDHPVYQRSKIPQSVRDHLLVSEPCHFSSTLRKHVRDVDVKEQWVEKTVYTT
FT                   AEPFPNILRRSEVVEVKEVALSPLHTALERTWRKTHELSMLQRRAASGEDTGLNNLSEA
FT                   LQQLLDLDAATPNCVAAYRQFLSDAHEEEEGGLVTPKPADPMKNALAVALIDHALGIKQ
FT                   ALALYHRPAHLATQAELTRRFEEAFGPEISSLRPAETEQAPQWPRRSTPESVKERQKPP
FT                   ASRALSPEQELIRSSRKNHSRKHSAKQSVSHRISVMNPFKRGNHVASNSVSTVQEDPKP
FT                   QSDSKVNGTTTEEHVNGEVDQDDAATIHSRTTTQSRDTHHKRRSRLGDVLHKHASSLSI
FT                   SASATEETQSQKKQRTRSASRDTAGKSHDSVSQTTSQTNGTSADDRPSVSSHKGGWSTI
FT                   PSITDYPRPVTRSSINSVRSPELMSPVSQSSGMRDSVFKRFSLLKGVSRKGSRLDFRTE
FT                   TPVREE"
FT   mat_peptide     complement(759637..765915)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q861 "
FT   sig_peptide     complement(765916..765984)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q861 "
FT   CDS_pept        join(complement(772925..773123),complement(770567..772854),
FT                   complement(769375..770492),complement(768397..769315))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877840"
FT                   /orf_name="An01g03190"
FT                   /protein_id="CAK43685.1"
FT                   /db_xref="HOGENOM:HBG323881"
FT                   /db_xref="InterPro:IPR019160"
FT                   /db_xref="UniParc:UPI0000EF9D75"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q862"
FT                   /transl_table=1
FT                   /translation="MSSRDRMRGPPPGEMPPQRDPRRAGDSRNGGNAGPGDASMSRAEK
FT                   FEDEKRRIIHSCFGKKDSDGSLVESYITHVRILEDAAYPSTPAPPNSPPENKKPRVIIV
FT                   AVRRSGRVRMHKARENNDGSFSIGKTWMLDDLSCIQSYNALVPSTPLEQQHKQWAANVG
FT                   FIVTVGKPYYWHARTSKEKDFFIGSLVKIYRKYTGGKVPTLIGFDDRERQLLAGGSAAG
FT                   PPAPKGPPPSGPPRPEVALPPPRPSSSQGSRPQSPYSSRAPSRDGPRRPPPAPSEEHVL
FT                   RAQRSRDQMGRPSTGQSGKSGTPPFSPPQHPPPLPPDQREQPPPRAAERLATEPRVPKV
FT                   PIISPPEPRNRDYPSSLQAAPVAGQRERPNGSFEEARSGSPLPDSRPPSSRDGRKGPES
FT                   RPTLRTHDLHPSRSTDGLRPTTPGSVSGENHTFMHSPGSSVGPRSPLREAAEKPIGSPA
FT                   RAARQEPEPPSNPINTPAVEVPAALTPGSSAFSKAPPAVESAEAPVPTAPTLSILTKDP
FT                   EPIEPIAETAAAAVPPPPSDLEATEPVEENDPDAHRPGLGPMIKKKQVKDVAGAFRKAA
FT                   TAHGAFKPRPGGAGERLLAAAKKQKAAADEPDGITSVVPAPFLLRTNSENTVTSPETPE
FT                   AETPPVVSSSPEKEVQPPAPPAPPAVQPPPEPPRIEPPAVEVTQAAPVEPTIGSTEVLA
FT                   EPRDTSRASVKVDTERSRSVSPSPHDRRRRRHEDNTIKYCQALGLNPTVLEGRGIDFDD
FT                   ILTDLGWNGRLGDEKKIEDLEADIRREIGRVETTSWLGNLEQQEGKIDQLAKLIDKTVV
FT                   ECEELDNLLTLYSHELNTLHDDVAYIETQSQGLQVQTANQKLLQNELQNLLRTLSISSD
FT                   DVRALKESSLSNPDGLRDTELALSTLYKAMLMIDSDIWHNKRRLADAAGDHGSLGVYAD
FT                   TEIGQMRAIKEKKEEYRTHARVFLQRLKQFMAIAYKVAEQKRIDAAANGQKDPLKLDSE
FT                   ARGYCRRELWQYNAVILFAREVSSGEWHALINLYEQQAKHPYQNDFRDNNLAWKKAARK
FT                   PSGEEQELLFTHQEKEKESEGITMAARKLTVRRGKTIRAAAGLRLPSGDKQHGKLEPCE
FT                   AFGGTLQETLHMISEEQNFIVYFFHLNSLSTVDFPDLVMSGAPDERRIPSFGSKQLHDP
FT                   DRAMAKKVEQIMDELFAFWPTDMQNLVDWAIRADPLQGIGILLAIEKAISEYDDTNQDF
FT                   IIHSLQKLHSRLLGLFNRFVDDQIRGIEETKVKVNKRKGVISFMRVFPHFSTAVENMLS
FT                   QEFYDIRVNVNEAYDRINRAMWESLKFIAKEAPGQPTGAAATSGDPEDKEILNYHILLI
FT                   ENMNHYIEEVDVRSLPVLERWRDRAHQDMQEHLKLYLDSIIHRPLGKLLEFIESVENLV
FT                   ATGINPADIASRPSHSRSVAKKVLATYDAKEIRRGIEMLKKRVEKHFGDADDPGLSRSL
FT                   VLKVLRECEGRYGEAYNRTRRVIDAVYEGQLELEWRKEDAIAMFQR"
FT   CDS_pept        join(complement(775691..775940),complement(775467..775634),
FT                   complement(775050..775399),complement(774267..774983),
FT                   complement(774139..774193),complement(773971..774008))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806931"
FT                   /orf_name="An01g03200"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43686.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG324210"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EF9D76"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q863"
FT                   /transl_table=1
FT                   /translation="MSLLSLPPRVQKAAAEMSDNESPGTARAELPRQFSFLSTLALGYS
FT                   ITNSWAGYAGILSIPLVMGGGPTAFFGLFLASIACCFITAGLAELASAFPTSGGPYHFA
FT                   FIVSAPKHRAAVSFVVGWLTMISWCTVSTSNGIVCAQMINGLVTVHRPSVTVTAWRIYL
FT                   IYLPIVLLSTVVVCYLPRVIPLIEDCIIIFSLLTFGTSLITVLAMQDQKQSAHTLFLAY
FT                   ENHTGWSDGTAFMIGAGTCMYAYITVDSVTHIADEVPNPGRNIPRAMMATVLTGMVTCI
FT                   PYAIAILFCTTDLKAVASSPIPIYTAYLQATSSPVVATLFTAWVIFFYCAAELSCLLTA
FT                   GRLAYTFARAGGLPYSSFFVKITNEMPLNATLGCCVFICLYGLIYIGSATAFDSFISIV
FT                   IIALNICYVVPQAIVLLRGRDAVLGRRAFAMGKYFGLFCNTVAVVWVAVILVFFCLPLK
FT                   IPTTVHDMNYASVVLAGFVALIGIGWWGGKRKTFTGPLQDIESPHSGQTGTARVHALSL
FT                   ALTSNCTT"
FT   CDS_pept        complement(776654..777628)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20654267"
FT                   /orf_name="An01g03210"
FT                   /product="Function: NADPH:protochlorophyllide
FT                   oxidoreductase"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAK43687.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9D77"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q864"
FT                   /transl_table=1
FT                   /translation="MSYSRSILITGGTAGLGYYCTIELARQFPDYQVIIASRSDSRDAA
FT                   GSINKLLGQSNVSYLRLDLSDLSKVRSFVQQWETNKYPPIQYLLLNAGLQFPGPVEYTV
FT                   DGYEKTFAINHIGHALLFSLLVPHLANTARIVVTSSGTHDPAQETGLPDAKYTSAEDLA
FT                   HPTKSSAQNPGRQRYSTSKLANVIWVYALHRRLSESKDARLKSWTVVAFDPGLMPGTGL
FT                   VREANPVLRFLWHVIFPRVIPLLRVMLGTPNIRLPQASGANLAWLASGKEASSSSGVYY
FT                   EGRKQIRSSEESYDVNKQDDLWDWTVRNVASTADEAARFSLIG"
FT   CDS_pept        777933..779495
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877841"
FT                   /orf_name="An01g03220"
FT                   /product="Remark: the systematic name of Upc2 from S.
FT                   cerevisiae is YDR213w"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43688.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022698"
FT                   /db_xref="UniParc:UPI0000EF9D78"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q865"
FT                   /transl_table=1
FT                   /translation="MGWAANIASPSQPDDPAPSQLLHYLPDYQVVICSACRYAVQPHGI
FT                   LRHLKEIHRILRGRRRKYSHYVASLSLREPNDVIPPSGADQFPVPYLPVEPGLQCQSAG
FT                   CKYLCASNKRMQSHWRTVHGRKADCTTDWRTVPLQTFFRGNHLRYFTSEGAKTNHALSD
FT                   SVFGGHTQELSENQLHAGLDSMDSALLDHYLRHTYQSFTTNQETDKIWRLVVPELAYKN
FT                   VFLLHGLLACTSLHRAHMSSGHTNQEKVFLLRAYHHQEIALPQFRYAIEHPTEDNCHAI
FT                   LAFAHLLVVYSFAADQPRCSNSNMGTDSLFLVDRNSGEGSQPDSILCKWLYFLRAGCSM
FT                   LCEVWEQLKEGPVKALSEAWDIDLGDDPDLPYLELFMSMIPNESATTHETGDVTETSLV
FT                   WPEDVTAIYRQAAIELSRSFSYVHAHRGLLTTWDVLRIWPMEVSLEYMALLHQRHPGAL
FT                   ILLAYYCILLKQMERHWYFEGRAAMLICAIQRHLKPEWHVFIREPLHTVLGVPDGGHFL
FT                   GEL"
FT   CDS_pept        join(779953..780012,780082..781200)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111053"
FT                   /orf_name="An01g03230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43689.1"
FT                   /db_xref="InterPro:IPR007718"
FT                   /db_xref="UniParc:UPI0000EF9D79"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q866"
FT                   /transl_table=1
FT                   /translation="MAGQKSKQAKPAKASKSKETPAPPAQLVAALSAFLSESGFSKTKE
FT                   AFTKELASKSIDSDAKNVPSLLELYQSWEKSSEKSSGSSSSDSDSDSESESGSESDSES
FT                   SDSSSDESSDSDVEMNDKSESDSDSDSDDEEEKKKPAAPAAKSQGTKRKAESSSSESDS
FT                   ESEADEAPKSKKTKVTSAKEESSDSDSSDSESDSSSSSSESEESSDSDSSSDDSSSSSS
FT                   ESDSDSDSDSDSDSSSDDEDDKKADKKALKAATKTPLPPSESSSSGSSPSSSSDSDTTG
FT                   TVSNSDSAPKEQSKSAQTSYSSSASPAPGNGPQKKKHTGARPTPLAQLSELPTDHLLSN
FT                   DYVPYAYAEKAWQDLSVTRGKGFTKEKNKKKRGSYRGGPIDISGGKSFKFDD"
FT   sig_peptide     join(779953..780012,780082..780144)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q866 "
FT   mat_peptide     780145..781197
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q866 "
FT   CDS_pept        complement(781851..783725)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806932"
FT                   /orf_name="An01g03240"
FT                   /product="Similarity to hypothetical protein B23I11.30 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43690.1"
FT                   /db_xref="HOGENOM:HBG329869"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000EF9D7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q867"
FT                   /transl_table=1
FT                   /translation="MLAELPPEIIQLITSYLPSASALVNLSRTCWRLHHVVAAQDWRIF
FT                   RSFVETKFPGVETPEIWREAAQALTSRSRALDKHAVVGRFVVPASEAVKVGSHSSTRRD
FT                   NPTHGYRPALDSYEVWNGSSWNDRKEVLAWGAADELVLRIAEPGPNSKGKWVVFNDLDH
FT                   ISSHDDICGVHILRPGHPSKEPQTEHIVVARARGELFHLSIDPNIACHIYKQRFMTSGG
FT                   GIERTDMSDGKDPILSAHLSDGSISFFSTTSGEAEVYPFARLNADSSNNATISSRHKYS
FT                   KFLSPSLFAVGTGRIHDAITISAITPQGLSPSRELNVELVDFERLNLDTTIRSNVNAIA
FT                   PLDPTGQVFLAAWGDRAIRYNHPICHYSTLYANTLRLHDLRSNEEYEKTYRDTTDQNPI
FT                   YCIHPFGHDRFVVGAGGDALVKIFDLRMPKHDTYSYRDARPSRTLLKNNEPIVDSLSSL
FT                   SLTATNNSIAFPRKDISIFLSAHPPSSRPQGRRRHNTRSYRGAIYSMTSPSPSSPTIYT
FT                   GVADGVVRLDFASTDDLLGPCQDWYREPLLLSNDVRLENTVAHTRSADKVLDLSGYERP
FT                   EDTTASITLRTQQPFVFVGVEDGLAEEITGWDRRWERLEKPGAWRRAD"
FT   CDS_pept        join(784604..784935,785004..786112,786177..786316)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877842"
FT                   /orf_name="An01g03250"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43691.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG323882"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000EF9D7B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q868"
FT                   /transl_table=1
FT                   /translation="MAISAVTLAATSFCILLLAYKLIIYPVFLSPLSKIPNAHWSAPIS
FT                   PAWIIWKRYRAQNNRTIQSAHVRLGPIVRLAPSEVSVNCVDGGIKSIYTGGYEKHEWYP
FT                   RVFGSFGTVSMFTMTNNKAHSTRKRMLSNIYSKSFLQSSPHIHLISETILLDRLLPIIQ
FT                   DAASSGSPIEMHDLDQGITMDFVSAYLYGLANGTNFLQDEAFRRKILRLYQSRKPFEFY
FT                   HQEVPNLVSWTKRLGLRLIPKWCDEANEVLDAWGLSFCDKADECLSSTQLNTEPMVYKQ
FT                   LKQSISKQLPPKEAASYNKLIEQQRLDIACELYDHLTAGHETSAVALTYLFWELSKHPD
FT                   LQSALREELHTLEPKILYPRPSSSRDLPTPKSIDSLPLLDAIVTETLRLHAPIPGIQPR
FT                   VTPSPGCTLVGYSDIPGNTRVSAQAYSLHRNPEVFPEPETWQPKRWLKDCNPSEVLEER
FT                   RRWFWAFGSGGRMCVGSNLALQEMKLVVAAIYTNYTTAIIDDEDIEAIDAYTVKPRGEK
FT                   LVLKFESVA"
FT   sig_peptide     784604..784660
FT                   /db_xref="UniProtKB/TrEMBL:A2Q868 "
FT   mat_peptide     join(784661..784935,785004..786112,786177..786313)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q868 "
FT   CDS_pept        join(complement(787108..787234),complement(786955..787034),
FT                   complement(786746..786844))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877843"
FT                   /orf_name="An01g03260"
FT                   /protein_id="CAK43692.1"
FT                   /db_xref="HOGENOM:HBG736580"
FT                   /db_xref="InterPro:IPR017264"
FT                   /db_xref="UniParc:UPI0000EF9D7C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q869"
FT                   /transl_table=1
FT                   /translation="MPPKGVSTRLNPVRLQSIPHLRVRRPNTNEPNTCVAVMSSMLSCW
FT                   ASQGYTHEGCAILEQQLRSCMDAPKPKTQRRNPINYHLMRMFPKVVGPKKKDGVLG"
FT   CDS_pept        join(787507..787881,787943..789046,789321..789626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654268"
FT                   /orf_name="An01g03270"
FT                   /product="Similarity to hypothetical conserved protein
FT                   B24M22.130 - Neurospora crassa"
FT                   /protein_id="CAK43693.1"
FT                   /db_xref="HOGENOM:HBG329871"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniParc:UPI0000EF9D7D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q870"
FT                   /transl_table=1
FT                   /translation="MSRRHVSAFYTNTVAPVCAPRRQSIPLSRCFSVGSVRRTAASSKP
FT                   GEQHENTKTQDETKEEEQGAMARRLSDMTEQAMLEGGRSAQRNMQQAGFSDELKQQLEE
FT                   RVAAAAFKNEYATAHSIVDMPSSAGQGTRDIAGAPAWTGTENTHDITLRMLDDSKKRIR
FT                   TPYKIPQPNPVDMRISPKPKESAGLRLAKARERRATYSLSQSEGISEDEREAMRREMRE
FT                   RFSPGARPMPATLQGLSALANERIEDAMARGQFNRIRRGKGVNTETDHRANSPFIDTTE
FT                   YFMNKMIQKQEIVPPWIEKQQDLAREVDRFRSRLRAEWRRHAARLIASEGGSLDIQMRR
FT                   AGAYAAAEARLAERAKIEQAFRESDSASSSGGLDSSDGAPQSSDSTVSGPQEDKDPLPY
FT                   VTPLRDPQYMNTERSFLELTIKNLNALTRTYNLQAPPVAQKPYLNLERELAACYAEVAP
FT                   SLAEEIKRRATERARPKNSGPQAANILESLSTSSKRRSRRLDTYCQTIPYLFDHGISVN
FT                   NPIYLTSSTAAPNHSVPVPQAPHRVQSANPDDCQQHITRCPQNSQEKRDSSIRPQTHQV
FT                   MSKIKSQYPGSKAVYERD"
FT   CDS_pept        791886..>792635
FT                   /pseudo
FT                   /gene_family="HOG000211622" [ FAMILY / ALN / TREE ]
FT   gap             792638..792737
FT                   /estimated_length="unknown"
FT   CDS_pept        <792858..793121
FT                   /pseudo
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT   CDS_pept        join(complement(795055..795633),complement(794537..794931),
FT                   complement(794345..794461))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877844"
FT                   /orf_name="An01g03300"
FT                   /product="Putative frameshift"
FT                   /EC_number="3.-.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK32619.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG329872"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniParc:UPI0000EF9D7E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q873"
FT                   /transl_table=1
FT                   /translation="MMLWVTLWWYFHEPQPDRRLQTDASANTPPSGQPKGDWRINIKRE
FT                   GFFKGRTLLQKLERMGLIASEDSSVGAEPYDPQCWANMFISRRSFWQIDPRLFVFTMSP
FT                   QTIPPSVSGSPFVQRVASPSRESFNLAHAAGQEVAHYVPNEGPFASTSHLPTYFPPPPT
FT                   QYTFTNGIRHPIRPKPPHQGDVFYVRYIPSPLTAGPSDLDLLHKWMNDPRVNASWGEAG
FT                   PIEHQEKFLRTNLNSRHSFPVIGCWDGKPFGYFELYWVKEDRLGPLIGGADNYDRGIHL
FT                   LIGEQEYRGPHRVQIWLSALVHYCFLADSRTQTVMLEPRVDNFKLITYLQEAGFYKEGE
FT                   VTFPHKQSALMKIKRDTWECPAI"
FT   CDS_pept        join(complement(797833..798091),complement(796670..797529))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877845"
FT                   /orf_name="An01g03310"
FT                   /product="Putative frameshift"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK32620.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG326214"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9D7F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q874"
FT                   /transl_table=1
FT                   /translation="MPLTILSQTQLRSLLLSLSRDQIIELQQNLSNALRDYSTGSQEKG
FT                   CAAAYQPTRTAITRQNGCTTLFMPASTGNTLGMKMISLQDNMTLIDETSLPFGLINAHE
FT                   LTPFRTALTATMTLNKRKRVRTVVVFGAGKQAYWHIRLALILRGEGIKRVYIINRSFDR
FT                   AAQLLRDIYSPENASWRGDVKFSAVSTDFVEYDRILHDALLKADAIFCCTPSTEPLFPA
FT                   QILTSRDGRRKGRLISAIGSYRPHMTELPPELLRDEVTVHSSHRHFHKHVRRSGVVVVD
FT                   SLDAALKEAGEIVQAGIRPHQVVELGELLIVRDASRGEGDNSEDGKSLRDWVERGNVIF
FT                   KSVGMGLMDLVTGGDLVRLAREKGVGTTLEEF"
FT   gap             798476..798575
FT                   /estimated_length="unknown"
FT   CDS_pept        join(798778..798807,798857..798977,799067..799275,
FT                   799311..799409)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111054"
FT                   /orf_name="An01g03320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36872.1"
FT                   /db_xref="UniParc:UPI0000EF9D80"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q875"
FT                   /transl_table=1
FT                   /translation="MEDYDLRGMGVPVVDGVKHLPTGRYIHRDSRTAVSAYLILSDYAS
FT                   FIPIPQSTFLAVNHPSPLATLTPSSSATATIGPSLCHLIARTDTCSSVQMIKPNTLVNT
FT                   HKIKWKIKITIMIIIIGANLPCLYIQMQDNIKSLINVIIKKDWAVWDA"
FT   CDS_pept        complement(799765..801063)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111055"
FT                   /orf_name="An01g03330"
FT                   /product="Complex: interaction of A. nidulans pclA with a
FT                   PSTAIRE kinase was shown in vivo"
FT                   /function="kinase activity"
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="CAK36873.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG329874"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="UniParc:UPI0000EF9D81"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q876"
FT                   /transl_table=1
FT                   /translation="MAVHPYSPCTNFASPTTNTTSIMDFDRAALHEFIMQPVSRDMISH
FT                   LAQQAMQVIRCEPHVTAHHAHGQPTPPSTPPLDADLPPLPSVTTFITSLVLRSQVQVPT
FT                   LMTSLVYLARLRARLPPVAKGMRCTVHRIFLASLILAAKNLNDSSPKNKHWARYTSVRG
FT                   YEGFGFSLPEVNLMERQLLFLLDWDIRVDEADLLHHLEPFLMPIRRRLQIQEQRQREAQ
FT                   LRQPREWRRFHASADLFAARLHRQKAEGRRMPGESPTRRRLPPSPASSASLSSVSSGSS
FT                   YCASPASVAESERYRPYPPRRRPSTRSHASISSPPAVQEVPGLSRAETLPSLSSRASSI
FT                   APSSRSDTPASLRTSSSITSMNEVHVVDGTRSPSVSNGYVSLAGTKVEELSQPNKKARH
FT                   SLSHAHGPGQTHPGFVARFLASAAGSYMGGRRH"
FT   CDS_pept        join(complement(803313..803635),complement(802844..803246))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181257" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806933"
FT                   /gene_name="xgeA"
FT                   /orf_name="An01g03340"
FT                   /product="Probable xyloglucan-specific endo-beta-1,4-
FT                   glucanase A"
FT                   /EC_number="3.2.1.151"
FT                   /function="cellulase activity"
FT                   /function="xyloglucan-specific endo-beta-1,4-glucanase
FT                   activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="polysaccharide catabolic process "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="CAK36874.1"
FT                   /db_xref="GO:0000272"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0008810"
FT                   /db_xref="GO:0033946"
FT                   /db_xref="HOGENOM:HBG344761"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="UniParc:UPI0000EF9D82"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q877"
FT                   /transl_table=1
FT                   /translation="MKVLALSALLSLASAASISRRSDFCGQWDTATAGDFILYNDLWGE
FT                   DNASSGSQCTGVDSASGNEIAWHTSWSWEGGSSDVKSYANAALQFTGTQLSSISSIPST
FT                   WKWTYSGSDIVADVAYDMFLGSTADASSDEYEIMVWLAALGGAGPISSTGSTIATPTIN
FT                   GVTWDLYTGPNGDTTVYSFVAQSTTEDFSGDLNDFFTYLVDNEGVSDSLYLTTLEAGTE
FT                   PFTGSDAELKVSEYSVSIE"
FT   mat_peptide     join(complement(803313..803590),complement(802847..803246))
FT                   /product="Probable xyloglucan-specific endo-beta-1,4-
FT                   glucanase A"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q877 "
FT   sig_peptide     complement(803591..803635)
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q877 "
FT   CDS_pept        join(804754..805036,805113..805139,805216..805553)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211245" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877846"
FT                   /orf_name="An01g03350"
FT                   /EC_number="5.3.3.-"
FT                   /function="C-8 sterol isomerase activity"
FT                   /biological_process="ergosterol biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="CAK36875.1"
FT                   /db_xref="GO:0000247"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006696"
FT                   /db_xref="HOGENOM:HBG717428"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="UniParc:UPI0000EF9D9C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q878"
FT                   /transl_table=1
FT                   /translation="MRCASFAVALLALFTGLYSYLNARLEQFYIFDPSHLHDLSQRAIA
FT                   AHGNDTRSVVNFIVSELGEKVTDTHLNLDEEWVFNNAGGAMGAMYIIHASITEYLIIFG
FT                   TAIGTEGHTGRHTADDYFNILQGTQLAYVPGSYEPEVYPQGSVHHLRRGEVKQYKMDES
FT                   CFALEYARGWIPPMLFFGYADTFSSTLDFPTLWATSRITGREMISNLLKGKM"
FT   sig_peptide     804754..804822
FT                   /db_xref="UniProtKB/TrEMBL:A2Q878 "
FT   mat_peptide     join(804823..805036,805113..805139,805216..805550)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q878 "
FT   CDS_pept        join(805910..806728,806951..807157)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225864" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111056"
FT                   /gene_name="ncs6"
FT                   /gene_synonym="ctu1"
FT                   /orf_name="An01g03360"
FT                   /product="Cytoplasmic tRNA 2-thiolation protein 1 "
FT                   /EC_number="2.7.7.-"
FT                   /function="ATP binding"
FT                   /function="tRNA binding"
FT                   /function="transferase activity"
FT                   /biological_process="tRNA thio-modification"
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytosol"
FT                   /protein_id="CAK36876.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005829"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0034227"
FT                   /db_xref="HOGENOM:HBG541846"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0000EF9D9D"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q879"
FT                   /transl_table=1
FT                   /translation="MPPSPCARCHDQRAVIIRPKNRQKLCRTCFLHVFETEVHETITST
FT                   SLFHPGERVAIGASGGKDSTVLAAVLKTLNERYNYGLDLCLLSIDEGIKGYRDDSLETV
FT                   KRNAQQYNMPLVIVSYGDLYGWTMDQVVAQVGKKGNCTYCGVFRRQALDRGAAKLGIKH
FT                   VVTGHNADDVAETVMMNLLRGDLPRLSRGTSIVTGSAASDIKRSKPLKYAYEKEIVLYA
FT                   HHRQLDYFSTECIYSPEAFRGSARTLIKDLEKIRPSSILDIVKSGEDMALLKKVKSQVL
FT                   GTCERCGYISSQRVCKACTLLEGLNKNRPKTAIEMEIGLEDEESSSTLRRQMEKVELGG
FT                   V"
FT   CDS_pept        join(complement(811593..811835),complement(811194..811515),
FT                   complement(810930..811116),complement(809079..810555),
FT                   complement(808599..809027),complement(808460..808539),
FT                   complement(807780..808392))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211257" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877847"
FT                   /orf_name="An01g03370"
FT                   /function="GTP binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK36877.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG323886"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="UniParc:UPI0000EF9D9E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q880"
FT                   /transl_table=1
FT                   /translation="MASQPLRRERASSDKADVAPFPQRPGLPSRTISAPVGGLYRLDSA
FT                   RTAMESGNKVDRTLLEEDENPPSAGGDRVPSLSREETTPKPSFPHVSIAVVGPDHVGKS
FT                   TFIETALDMKHPLSSRSTTKKMSLDGTVYLVRLMEIDTLEISIGSNGEVNWPLLGNDSP
FT                   PTVDGVLVLLDMTQPASFPEFTELLDSLTASDIPFTLVASKCDIQPPDSPVEPILGGYE
FT                   IHRTSPDSPRSQKMCIALVLRSVINRKYGFIDFPPNSSATPDWHHSRTNSETPTAVLSG
FT                   AAGGPITGPLDPAVDGYGVDRQPTEPATSANLASNGQAFRYARSNSHPVRPHTPPSGSR
FT                   LASRKQSVSGESSPSKDLNRQHRLHTAWRNSGGSDAFSNFLEMGEDFDGPRSAPSSPGS
FT                   KDQTPSESSSNDAGLTFDELVDRLVAQPMSKQDSKFASIFLCLYRKFAAPCTLLNALIN
FT                   RFERNENDMTDQLDRIAVQLRLLGVMAQWVSEYPGDLAYPKTRKRITDFVTTLEKSHFY
FT                   MFAAKEIGSYLEGNAEDDNIGWPYRDGDMEEPDTADPPFQFSGRSSPSIFLGAPPLGDE
FT                   GEEEEEDPIYNMSALDLSEGAAEPASRLSGSMSNSFTSEKPGTIASQSFTFLSTEAAQR
FT                   EAHNLDLTPRIPLTKVQWRQLMEIPDEDFARELTRIDWIMFNSFRPRDLVRHVSISGVE
FT                   KDKILSLKHVNRMIKQFNHVAFFVASVILLRDKPKHRAKALEKFMNIALKLRRLNNYNS
FT                   LGAVIAGINGTPVHRLSQTRELVPVQTQKDFMRLVILMGTQKSHFAYRLAWDNSFAERI
FT                   PFLPLHRRDLVSAEEGNKTFVGDNKNRINWRKFEVMGEVVLGIQRSQKTPYPHMPKYEE
FT                   VERLVLEIKLSGDDEDLYSRSMQVEPSAGGDTGRKKFGWLRSTSTKLTSTMNDDRHLID
FT                   DDVHNVVSTTTRPYLVTNLREKCKNHVIYNHRKPNLSVAHPPSNQTYHLHKSHIYNPHK
FT                   LLKQNPKEKKKNIKMSTAIKTSYRALLRELPRRTLSTPTPLQHRLRDMYTTNQQQASVA
FT                   DADAQEALRQHRIDQANQFAIYAKAQRVYAELVERYNPGTTLDEEERIRLTARRVGWDL
FT                   PVEAGKKDE"
FT   CDS_pept        join(complement(815147..815217),complement(814577..815075))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211268" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877848"
FT                   /orf_name="An01g03390"
FT                   /product="Similarity to hypothetical protein CAD21197.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK36878.1"
FT                   /db_xref="HOGENOM:HBG329876"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI0000EF9D9F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q881"
FT                   /transl_table=1
FT                   /translation="MPGTCEVCVSEPSKYRCPTCGLMSCSLACTQSHKIYCAPKAPSPK
FT                   PTGPTVDIQQPPGESNEHAASEITPKAQNGLDIKALGSSTELKDLLDRFPSLREELYDI
FT                   YKTTLEDAWVETQRFGGRGRHHGRGKGPHRHNGPWTREKGFNRGVGRVRRLRERCEEGL
FT                   ETGKKAEGYVRFMSLVTGNELPRETM"
FT   CDS_pept        join(815743..815802,815891..816418,816483..816623,
FT                   816777..817553)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234474" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111057"
FT                   /orf_name="An01g03400"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36879.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9DA0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q882"
FT                   /transl_table=1
FT                   /translation="MGGIPFRSTGCNTCRRRKVKCDEAKPECNRCIKNGHVCTGYERKR
FT                   VFIHKSSEAIEEGELKLVRRPQSTSGKIPDRQLTRVEPGFPRLNNNAEVRSQLLASFVG
FT                   GFLPSSRHLQDGKDTNILKTLPELCGNSPLLDRALLSLSSAFLAKQHKDDRLLGYSTKL
FT                   YNNSMEIMHGKIKSGKGLGQDVLYTTVVFQLYELIHSSPPGFMAWIAHVQGSNAIIKQC
FT                   RVNKKGTIAEKLFHRQLKFVTGSTELEPIDELMDLLAECSALIEQVDTFIEQLPASPDG
FT                   DKNNGEKLLGSCLSLEERLHQTCLKMQEKLGAPSTLTHDVPLREDLRAHLATSLFPDPF
FT                   QFVSLACAESHLIYWATLIILYPLVDELLDVLGYRRNDVTPSQSCAIHPQAIEQRPLGV
FT                   DVATDFTALAEHYADEVCRSVMYCTQSDMNTLGAQHLLAPFSQCAQFFQVHELAQKYRW
FT                   CQGVFVLLDSLGLGIAPLLKDMVWPQYRSARLRRSLSSVGKVP"
FT   CDS_pept        join(818338..818637,818718..819254,819324..819479)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000023557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877849"
FT                   /orf_name="An01g03410"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="CAK36880.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG294208"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="UniParc:UPI0000EF9DA1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q883"
FT                   /transl_table=1
FT                   /translation="MSVSSASGNMLRRTLFSVRLTTQQLNAAECSSRIAKPAVFGSYRN
FT                   VHRSARLPAITASEARRRPTLKPHQHSLVQARVNGPSPSSKRTIFIQTENTPNPDALKF
FT                   IPNHRVLPENFPTTFLEYLSPRSTLAPPHPSPLAASLLNVDGVTSVFYGPDFITVTKAT
FT                   DSNWAHIKPEIFSLITQAVTSGEAIVNTVAKTGESGQEGGESESLAYEEEEDEVIGMIK
FT                   ELLDTRIRPAIQEDGGDIEFRGFENGIVLLKLRGACRTCDSSTVTLRNGIESMLMHYIE
FT                   EVQGVEQVLDQEEEISMHEFAKFEEKLRQQKGAAATASTGGKGTLDSAP"
FT   sig_peptide     818338..818418
FT                   /db_xref="UniProtKB/TrEMBL:A2Q883 "
FT   mat_peptide     join(818419..818637,818718..819254,819324..819476)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q883 "
FT   CDS_pept        join(821100..821107,821310..821652)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654269"
FT                   /orf_name="An01g03430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36881.1"
FT                   /db_xref="UniParc:UPI0000EF9DA2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q884"
FT                   /transl_table=1
FT                   /translation="MPCHDAYCLYPSYLSPPTNQHKMCMQGGSSASDPIDDATQSTRHL
FT                   MTAASTAHANIALQDVQTWKKIRSALIGERLRTICPPGQQTALEWAGLALGSSITLDEK
FT                   SCQGQTLDTMQP"
FT   CDS_pept        join(823925..824040,824181..824307)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877850"
FT                   /orf_name="An01g03440"
FT                   /product="Similarity."
FT                   /protein_id="CAK36882.1"
FT                   /db_xref="UniParc:UPI0000EF9DA3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q885"
FT                   /transl_table=1
FT                   /translation="MADGVLTLLFCCWSPAACHTPPAAAAAVAAAATDVHSLQSEPVYP
FT                   SILPGSLSLSLSRLFCPEALEDPFPILRPMVPYRI"
FT   sig_peptide     823925..824017
FT                   /db_xref="UniProtKB/TrEMBL:A2Q885 "
FT   mat_peptide     join(824018..824040,824181..824304)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q885 "
FT   CDS_pept        join(827145..829291,829353..829875)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211279" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877851"
FT                   /orf_name="An01g03450"
FT                   /protein_id="CAK36883.1"
FT                   /db_xref="HOGENOM:HBG329880"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniParc:UPI0000EF9DA4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q886"
FT                   /transl_table=1
FT                   /translation="MAAPAGKSTAQATKPVTSSTPTSNVSARLEKTHPGVRRSTPDSEA
FT                   LASSDDDGDHSQQVATSTTMPAPKPARRTSWLNEVPATATRKASLTTSGPLSTGASNPS
FT                   SPATDQSGWPNTSPGIGNSIPWNHVGNSSFPWAAGIWNTESRKEPPPRLAEIVPSPTMS
FT                   NPSTASNYFTEEILSPTTRTTAGDSAIPFSIPLHPTPKTYRSQSYSVGQLDPEFLSFMA
FT                   NKSSKPYSGGRPRNGNQFSALQHRSSRPSLLGELGHDPATLGRVREDDDDDAGSPDGSD
FT                   GSFSNYAANQARTIEQLSRENALLRQAAGQMDNSMRDRTMSSASAASGYAIGSGIHNLH
FT                   RIRGSVPEETDLAVEDLDEVGDIPGYNNIHSSGRRRLSEHSANLEKQLPPYTSYQNRTL
FT                   ENVRKAHWQTSLDFGSIADIPQSRRHSFADIPMRHASVSGESQAAASTRAGMGDREEDY
FT                   ANIVDGPLSNVQGQNREYPRFHVAPRPEEHEMETEYLRARRFAEAYFARDPVLRAADGP
FT                   ASMATSLHQAYTMPNAYGRHQPGLAHSHQNQLLYIATFKCHRADVFYIQEDTGLQVKPG
FT                   DLVIVEADRGTDLGTIQHANVSMQRARELKQQYAEEHYKCLMMFSRQGQNGAANVVNAP
FT                   SGVPGLNNRSAIGGMGPHGPHGMQDSAADIKPKLIKRLAQNHEILTLREKEGNEAKAKR
FT                   VCQQKVTEHRLNMEILDAEFQMDWKKLTFYYFADSYINFNSLVTDLFKIYKTRIWMSAI
FT                   NPASFVTPPSAGLSAPNPLAYNHDAQADRPLDGRIYGHPRDAMGTGRDIGANQMGMLRN
FT                   AYVDSYQPFSQASRQPELGGLASVDPFTPYSANNYGSLDSGYVDYGAGTGASSGPSRLH
FT                   AAPSEWINNRFQGLSLNS"
FT   CDS_pept        join(831046..831132,831358..831514,831575..831801,
FT                   831876..832016)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229584" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877852"
FT                   /gene_name="rpl15"
FT                   /orf_name="An01g03460"
FT                   /product="Cytoplasmic ribosomal protein of the large
FT                   subunit L15 rpl15-Aspergillus niger "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK36884.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG577798"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="UniParc:UPI0000133BFA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q887"
FT                   /transl_table=1
FT                   /translation="MGALKYVEEIQKKKQSDVIRFLLRVRCWELRQLNAIHRASRPSRP
FT                   DKARRLGYKAKQGYVVYRIRVRRGGRKRPAPKGATYGKPTNMGINQLKYQRALRATAEE
FT                   RVGRRCANLRVLNSYWINQDSTYKYFEVILVDPQHKAIRRDARINWICNAVHKHREARG
FT                   LTATGKKSRGINKGHRYNNTRSGRRHTWKRQNTQSYWRYR"
FT   gap             832151..832250
FT                   /estimated_length="unknown"
FT   CDS_pept        join(832907..833093,833153..835264,835327..836231)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654270"
FT                   /orf_name="An01g03470"
FT                   /product="Function: human E6-AP is a ubiquitin-protein
FT                   ligase"
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK36885.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG329881"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000EF9DA5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q888"
FT                   /transl_table=1
FT                   /translation="MTSGKCMVCNSTVRWPRNLKVFRCTECLTVNDLEPFVDSGKAGGN
FT                   GLSGSDGKAPTPAVPRKAMPLSIERTKTILDDCLSRYLQQLLAPQQQNSTPENYSGKYL
FT                   DVAQDENLSQSPTQSSGYLSEPRPLVDPRGRSSSTSSKPVKTEGVSGVPNYSKPNLTPS
FT                   YAHGERKGSEMRSRDAQNAPRRDRSPRNAARSNGPEARGPTSRPYIFRSLEEYIITSFK
FT                   GCDCLNSSFTTAQPAPRNAGNSSPPKQKAEPSSAQAPSQVTFEPDPKLLLLGDIAENSS
FT                   WWMNEVEQISSSHRSRSRERREKTSSSSRPVSSRSPRINWAELAQWHHMIMTAGTSWVE
FT                   LWSTMKPTEMKKEEDAVIAQKWNATDLAMVDREITESRLHLHRTLLKATENLLKRPRRP
FT                   LKRPEDTRFLLMLLTNPLIYSSSSSFASYSLAPSAARGDRRPSHPKDGTPRPAPRNPKP
FT                   PPKPRSNGPGHHYGIVKRILGLLANLPNDCHHYLVSWFSRFSAGQFEKIVDLVGGFVTH
FT                   RLMRQHGRKRSESAQHDDDLVPSFSSAAGHTPAELHAAINGRSPNKANEQRDQPVVYTD
FT                   DWQVRAAARVMYLLFTANNANVSRKPDGVLGQDAGSVARNQASRRGHMIPISSFYNTLL
FT                   DYSDLVADFEAWESKTTKFSFCQYPFFLSIWAKIHILEHDARRQMEVKAREAFFNSIMS
FT                   RTAISQYLVLKVRRDCLVEDSLRGVSEVVGSSQEEIKKGLRIEFLGEEGVDAGGLRKEW
FT                   FLLLVREVFDPHHGLFIYDDDSRYCYFNPYCFESSEQFFLVGVLLGLAIYNSTILDIAL
FT                   PPFAFKKLLAAAPLSSITRPMYKCSLDDLAELRPALAKGLRALLDYEGDVAETFCYDFV
FT                   AQVDRYGETVSVPLCAGGENRPVTNANRREFVDLYVHFLLDTAVTRQFEPFKRGFFTVC
FT                   GGNALSLFRPEEIELLVRGSDEPLDVASLRAVATYDNWSNARPETEPVVRWFWDFFEQT
FT                   QPQAQRKILSFVTGSDRIPAMGATSLSIRLVCLGDETSRFPTARTCFNQLGLYRYETRE
FT                   KLERMLWDAVLNGEGFGLK"
FT   CDS_pept        join(838062..838075,838136..838205,838280..838348,
FT                   838413..838775,838831..839143,839200..839393)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877853"
FT                   /orf_name="An01g03480"
FT                   /EC_number="1.1.1.14"
FT                   /function="L-iditol 2-dehydrogenase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK36886.1"
FT                   /db_xref="GO:0003939"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9DA6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q889"
FT                   /transl_table=1
FT                   /translation="MKALRYEKPESHGIVDVPLPELRDNDVLIKVKACGVCGTDLHIHE
FT                   GEFIAKFPLVPGHETVGVVAAVGPKVKGFNIGDRVVADNSELCGECFYCRRGDELFCEH
FT                   FEAHGVTMNGGFAEYCAYPAGRVFKIKNLSDVDATLLEPASCAAHGLDKIAPKMGSSVL
FT                   LFGAGPTGLILAQLLRQCGGCRVVVVAPEGLKMDLAKSLDAGDEYVALSRQDPSAQFQK
FT                   LKDENPYGFDIVVEATGSVKILEDSINYVRRGGKLVVYGVYSNKDRVSWPPSKIFGDEI
FT                   TILGSFSEVYKFPAAIDYLDSGKVKVKGIVNKTFKIDQWEECLAAMKNKTAIKAAITFD
FT                   "
FT   CDS_pept        join(839882..840294,840368..840896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877854"
FT                   /orf_name="An01g03490"
FT                   /product="Similarity to hypothetical protein CAE76442.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK36887.1"
FT                   /db_xref="HOGENOM:HBG329882"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR010414"
FT                   /db_xref="UniParc:UPI0000EF9DA7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q890"
FT                   /transl_table=1
FT                   /translation="MVKPLTFKGDKPKKRKHTSTSTSTDPSHPAKKQSTSTSTPTANEA
FT                   EDPSTHDEHTLSDQSWVSADTSSDISGPILLILRTTPPTCLATDAHGTVFASALENMIE
FT                   GDPRTAEPHDVRQVWIASKIAGIEGWSLKGSNGRYLTSDKHGILSANASAISQHEIYTI
FT                   SESGAGGGGFFVFGTGTGASSASQGGDGVDDKEKKEKKQTYLVARTVASKTTASGTKVE
FT                   IRGDETTLDDGEEDGGGTNIRVRMQARFKPRIQASKEIKAREKIGRKELEGIVGRRLDD
FT                   DEVKRLRKARKEGDFHEVVLDVRVRGKHDKFA"
FT   CDS_pept        join(complement(842979..842990),complement(842706..842866),
FT                   complement(841719..842146),complement(840990..841666))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211301" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877855"
FT                   /orf_name="An01g03500"
FT                   /product="Remark: RZF of S. pombe is also called SPBC15C4.
FT                   06c"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK36888.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329883"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0000EF9DA8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q891"
FT                   /transl_table=1
FT                   /translation="MAVRHTGYPGWLGQANLIREEPAQKQYPSKLQISLLGLGLVQLAA
FT                   AIIRNGQSNQPDLLGNQNPCNNTTEPYIPDNVTRLQGVTPFDGRVIGLAPWISDECSQA
FT                   FLNVSQGTVPAALLFFLPSNDDKKPPAANDPAWQLGGSASWQSQSNFPVYGIPGAAGAT
FT                   LMEQLSRDGSVPDPDDQDNLTALSSSGASRLIAVIDIDSGAKKMPSIWGFILAILGTVL
FT                   VLTIILLLFYQLVHRRHQRELQRRLEAGEADLEQLAQLHIKVPPEFLETMPIYIYMGDG
FT                   DDNESTHENSTPGNLPRITEHSAEDIDPKTPTVAIREADNEAEKAIDGESIRRPSQATI
FT                   AGHPDAYVRHKNRLSRQQTTCAICLDDFEPDLSAVRELPCGHIYHPPCIDTSLTQSSSL
FT                   CPLCKKSVLPSSWFRFPPEDPWLQPH"
FT   CDS_pept        join(843556..844102,844206..844657,844700..845701)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877856"
FT                   /orf_name="An01g03510"
FT                   /protein_id="CAK36889.1"
FT                   /db_xref="HOGENOM:HBG329884"
FT                   /db_xref="InterPro:IPR019340"
FT                   /db_xref="UniParc:UPI0000EF9DC9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q892"
FT                   /transl_table=1
FT                   /translation="MPSANKGKGKGREARPSRSRNTTPNSSFSAGPTASAPLHSYLDND
FT                   VSKLMMTGSTIQYGELLERMGGVGPIPDSKSLELLMEHLKTLSQLAETRGDACNAGIRE
FT                   LSQKRKEVVEEQESAEREGADRVKMKREADDEEEEKVLKGGKLKRRKERGSSSKEERPL
FT                   THGAHDVARQDGAETKVEGASKKSKNAASEEASSLSPPLRKSPQPAADEDAEDAGSPGS
FT                   DDSSDSHQPEPAPAVPQVQVFGPNPLKFDDPTIYHIREVTPDMTDEEKKAIYSVARFPW
FT                   SDLSHLMAGSPPDRDFSSSKPASQVNANTFLAYIDPYVRPLTEEDIAFLKEKTQGDRTT
FT                   PFIMPRRGKKHYTDVWAEDDGLMNVDQPNGDKERLPLNQGRGNIDQVTDETVETDKVSV
FT                   GPLVSRLYSLLRYEHRALPDETAPNANGSVNGDMANGPMNPDSMDIDHPTGEASNETKP
FT                   LPSATAFPDSSPNNFKVPAAKLDHAQLDERLKAELRHVGFLGPDDNPDYDAHYDDDIAQ
FT                   RLRLLQSELKKQMIINSARKTRLLDIARERMAYQEYMTIHDDLDSQVQQAYLKRTRTLG
FT                   KSKKGSQAKHRPGGAGGGSHVVSAAGVGRPAIGDVARTLMDRRKRWRDCIGLVFKDSKT
FT                   SVPGKNESVFEPSLMAEIEKAEVEGWDEEQD"
FT   CDS_pept        join(complement(847967..848009),complement(847533..847907),
FT                   complement(847275..847459),complement(847013..847218),
FT                   complement(846139..846787))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877857"
FT                   /orf_name="An01g03520"
FT                   /protein_id="CAK36890.1"
FT                   /db_xref="HOGENOM:HBG329885"
FT                   /db_xref="InterPro:IPR009348"
FT                   /db_xref="UniParc:UPI0000EF9DCA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q893"
FT                   /transl_table=1
FT                   /translation="MIKAIFYSKFDTQEGPKVVHQVPDGAIVPSATAPSQPLFLTFSDI
FT                   SFFVIPRQELCGNLIQVCTNGYRILGYPICMKSLRYDRNEFIFNFCVVLAEEEDFSTYK
FT                   SVVQKLADLMHGLEEQNGFLSRDHSKSGEGKVYSLFHCVSTQTQDANWDIPDELNTLNI
FT                   KLFPIYPAPPPVKAWHVPLFTVRYQTFMDENWDLTMQRIVPHINGVNSVRIISILADTD
FT                   FSLTCRAIRHLLYYGCLFLLDIFSFSAIYAPTAQFSSTIATDEEMQQETASPAPGTATD
FT                   DDTATTTDIHPTEPQLVDGVGIVELYASLKQGQSIKQWYLQHSRQLAHIDIRRFITFGV
FT                   IKGFIYRVHKYAVATGNPAPPMKSSHYHHHSSPALHPPSGPSSRGPGTGTNSPYATSAG
FT                   DDPAPIAQHDGGPSHHSTSVYSGSRPATIVTLEGEEEEDDIDDKTLSKYLDGMHCFDQI
FT                   CTELEISERELTARLKRFPGEVLILHR"
FT   CDS_pept        complement(848525..849439)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877858"
FT                   /orf_name="An01g03530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36891.1"
FT                   /db_xref="HOGENOM:HBG329886"
FT                   /db_xref="UniParc:UPI0000EF9DCB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q894"
FT                   /transl_table=1
FT                   /translation="MHKPSLAQIVHSTLFPRPRASDPATFSAHITRNLVPEVRVETSTF
FT                   YGSLDCPEAQYPGLDYSYGPHRMRLGRFPWHRRLFRAFDELGLTETEISSLCRWEGTKS
FT                   ARERYEKEEGVKVRDTTADNIRPASPSPLPSIEVHYEDETEEEEEEELLPEPEYPVVTF
FT                   ETVRSTSSLIDDRGIDCIVEEKEEEDSSDDEMESCGVELNHRLIAATAAREQGADVSLD
FT                   EDWEQWLKEAGERGSYTDVLSAIRMGQPLGYLYDTSPPMPPLGRVGGRSSASLSEPFVL
FT                   PTPSMLSSRGIQRYAHSSSRTAR"
FT   CDS_pept        join(850523..850649,850767..850791,851025..851242,
FT                   851300..851328,851555..851653,851700..851853,
FT                   851910..852178,852228..852812,852864..853973)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211345" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877859"
FT                   /orf_name="An01g03540"
FT                   /protein_id="CAK36892.1"
FT                   /db_xref="HOGENOM:HBG329887"
FT                   /db_xref="InterPro:IPR011084"
FT                   /db_xref="UniParc:UPI0000EF9DCC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q895"
FT                   /transl_table=1
FT                   /translation="MNGTETCAGERVLTPTRLTLIACKATWSLAGLSLPVGFTPAPLTG
FT                   RGWAGQPPRLGTTATTTASRHPSLSTSRLFFQLIIVPHAAFDVGLPPSTQDELSCVPLQ
FT                   PWSIATQPRPMSTFDGFVREFPSIQSKKLMLLRIEKYPHRMNFSKGILESRKLHYKHLS
FT                   KLLRPIPLNTPTELDLTPRLSIRATLFDANHCTGAVMFLIEGNGKAILYTGDIRAEPWW
FT                   VNSIIRNPVLIPYTLGNKQLDNIYIDNTFARPSHVCHTFPSKAEGLKELLNKIQAYPDR
FT                   TTFYLRAWTFGYEEVWMALSAALNSKIHVDRYQMDLYRSLASRSVNDAPFLCGYELGNR
FT                   FVPGCLSEDEGSRIHSCEPGVHCPVAASRDTVYIRPIVTRTDDGLEMPEIGAGGGGGDL
FT                   YQVHELELPDQSALEQLEKLCSERIHDIHALSQTRQALIDAFRSKTKALSLDNYGMKDA
FT                   HDLPLEDLVGILSRGRPDDDSASSEANQHTHLRDRQGNPLPRIIHFPYSRHSSYSELCH
FT                   LVSAFRPKDVYPCTVDPVSWEEEVSMQTLFGHLCSATGFAHDQQMRDLTAKDPEIRARK
FT                   RARYEGSFTTQSSQQTSSMIDSSIPEPLQLSHPPRPAATIDPLSSSDRIPLPSSLEPIE
FT                   ESAPVPTDQPLIIPALSPETAKARRDEIRRAWHMLNNAEPSQRALYQLDSLPSSWTDEE
FT                   TELPKSEIAPTPHPPLDNPPHPTSITAPKHTLPIETQTSTITNTYPGTQNLTTDTQPSD
FT                   SLPRPDETENQTQTNSQSSEPLSLASSTFESQELEPDIEQRQDDESIIPNYDGTTDHNT
FT                   TSHHRRRHQQQRQQSLRRSVSAQIRRDAYLAARADSFEAWAAVSLISTGDNHTEEEIEL
FT                   "
FT   CDS_pept        join(complement(857150..857170),complement(856980..857066),
FT                   complement(854754..856811),complement(854636..854695),
FT                   complement(854319..854588))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000075064" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877860"
FT                   /orf_name="An01g03550"
FT                   /product="Urease"
FT                   /EC_number="3.5.1.5"
FT                   /function="nickel ion binding"
FT                   /function="urease activity"
FT                   /biological_process="urea metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK36893.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009039"
FT                   /db_xref="GO:0016151"
FT                   /db_xref="GO:0019627"
FT                   /db_xref="HOGENOM:HBG357507"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR008221"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="UniParc:UPI0000EF9DCD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q896"
FT                   /transl_table=1
FT                   /translation="MHLCPKELDKLVISQLGFLAQRRLARGIRLNHAEAALIRDGQYSV
FT                   ADLMSIGKSMLGRRHVLPSVVSTLYELQVEGTFTTGTYLVTVHNPISSDDGDLEKALYG
FT                   SFLPIPPADAFPDPDPEDYEPEKTPGAILPVKNERIILNEGRKRIKLKVMSRGDRPIQV
FT                   GSHYHFIETNPQLHFDRLRSYGYRLDIPAGTSVRFEPGDTKVVTLVEIGGHRVIRGGNC
FT                   IASGKVDLARAEEIMARLQVQNFAHVPEPTADSALVPTPFSMDREAYARMFGPTTGDLV
FT                   RLGLTNLWVRVEKDYTSYGDECTFGGGKTIRDGMGQSSEKSTQHALDTVITNALIIDWT
FT                   GIFKADIGIKDGLIVGIGKAGNPDIMDGVTPGMTVGSSTDVIAGENKIVTAGGFDTHIH
FT                   FICPQQVDEALASGITTFLGGGTGPSTGSNATTCTPGPVHMRQMLQACDRLPINVGITG
FT                   KGNDCGGVSIEEQIYAGAAGLKLHEDWGSTPAAIDSCLDLCDKFDVQCMIHTDTLNESG
FT                   FVEQTIEAFKNRTIHTYHTEGAGGGHAPDIISVVEHPNVLPSSTNPTRPFTLNTLDEHL
FT                   DMLMVCHHLSKNIAEDVAFAESRIRAETIAAEDVLHDLGAISMMSSDSQAMGRCGEVIL
FT                   RTWNTAHKNKEQRGPLPEDEGTGADNFRVKRYVSKYTINPAIAQGMSHMIGSIEVGKIA
FT                   DLVLWTPSAFGVKPTQVVKSGMIAVSVMGDPNASIPTVQPVIMRPQFGNTQALVPSTSI
FT                   TFVSQASLDAGIVQSYNLQKRVEAVKNCRNIGKADMKFNDIMPKMHVDPESYRVEADGM
FT                   LCDAEPAGSLPLTQDYFVY"
FT   CDS_pept        join(complement(859620..859700),complement(858684..859070),
FT                   complement(858189..858628),complement(858078..858093))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877861"
FT                   /orf_name="An01g03560"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36894.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG329888"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0000EF9DCE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q897"
FT                   /transl_table=1
FT                   /translation="MSRREDSKARDDTVTVNVEDFTRTRDSVVSSLVQLSAAVSELTKA
FT                   YLNHADTVLGRTPTALDISSITGITSSLYESGLLGARATSPGAKSEVGEKKKRKRAPPD
FT                   PNAPKRALTPFFLYMQHNRSRIAEELGPNAKPKEVSDEGTRRWAEMPEVQKEVWKKLYA
FT                   DNLAVYKEKVKAYKAGLPYSDDAKAASQLHQGIEGAEATEASEDEEQESEEESEEESSP
FT                   EPVKEPTPPRSTKRRRSEGKPAAKEAPTPSEKKKESPEKKKRGAAARKEKEQEETPARK
FT                   AAGGENKRATKKKRKSEAGAEDCYVM"
FT   gap             859956..860055
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(861429..861473),complement(861042..861321),
FT                   complement(860911..860985),complement(860285..860853))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654271"
FT                   /gene_name="mcr1"
FT                   /orf_name="An01g03570"
FT                   /product="NADH-cytochrome b5 reductase 2 "
FT                   /EC_number="1.6.2.2"
FT                   /function="cytochrome-b5 reductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAK36895.1"
FT                   /db_xref="GO:0004128"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG591994"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniParc:UPI0000EF9DCF"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q898"
FT                   /transl_table=1
FT                   /translation="MFARQAFRCAQPLKQGFRKYSTEAPKGKSSLAPIYAAVGITGVGV
FT                   GLYRYNSATAEAPAAVDRPKVFKGGDQGWFDLKLSEIEVLNHNTKRLRFEFEDKEALSG
FT                   LQVASALLTKFKPADAKAVIRPYTPTSDEETPGYIDLVVKVYPNGPMSEHLHSMNVGQR
FT                   LDFKGPIVKYPWETNKHNHICLIAGGTGITPMYQLAREIFKNPEDQTKVTLVFGNVKEE
FT                   DILLKKEFEELENTYPRRFRAFYVLDNPPKEWTGGKGYISKELLKTVLPEPKEENIKIF
FT                   VCGPPGMYKAISGTKNSPTDQGELSGILKELGYSKEQVFKF"
FT   CDS_pept        join(complement(864074..864105),complement(863838..863883),
FT                   complement(863770..863773),complement(863209..863393),
FT                   complement(862960..863136),complement(862745..862897))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211377" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654272"
FT                   /orf_name="An01g03580"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK36896.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG319315"
FT                   /db_xref="InterPro:IPR002670"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="UniParc:UPI0000EF9DD0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q899"
FT                   /transl_table=1
FT                   /translation="MKPAADAIGGSRHTSRRLTTTASTIKMGRLTEYQVIGRHLPTEAN
FT                   PTPKLYRMRIFAPNTVVAKSRFWYFLTQLRKVKKANGEIVSINVISEKRPTKVKNFGIW
FT                   LRYDSRSGTHNMYKEFREMSRTEAVEALYQDMAARHRARFGSIHILKVVEIENADSIRR
FT                   PYIKQLLSKNLKFPLPHRAAHGKKLFAYSRPTTFA"
FT   CDS_pept        join(864244..864809,864860..865085,865141..865671,
FT                   865727..865813)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654273"
FT                   /orf_name="An01g03590"
FT                   /product="Similarity to peptidase HPEP-6 from patent
FT                   WO200042201-A2 - Homo sapiens"
FT                   /EC_number="3.4.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK36897.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG329890"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="UniParc:UPI0000EF9DD1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A0"
FT                   /transl_table=1
FT                   /translation="MSNIFDDFKEGQKIGSGARLAASLSPVATAEYPDRLKSFYYFSNA
FT                   AHVSADLRYSLFQANGLRLPKQEQNSWVDIFTAYWKAVGEIVRFDDSPRHASWVKVFDA
FT                   WKDTANQLIRGYSTGSLQAWTVPCLYSVGRYLRAFAMKADAELSAQDSVTFDDRFQDDA
FT                   TDAKNPKLEEATRVLNRMFTLCLSDRAPIEESRKWGIYDTTNLLFKTYFKLNTVGLSKN
FT                   LLRALNASSADLPGLDAFPKSHIVTFEYYVGVIHFLDENYAEAEEHLSYAWRMCNKHAT
FT                   KNRESVLHMPPHATLLTTSRLILTYLVPCHLVTTHTLPSKKLLAPFPRLEKLFRPLCDC
FT                   IKRGDLGGFDAAMTAGEEEFVKRRIYLPLERGRDIALRNLFRKVFIAGGFDEPKEGQPP
FT                   IRRTRVPVAEFAAALRIGTHADDRSRIDIDEVECLLSNLIYKGLMKGYIARERGMVVLS
FT                   KGGTAFPGTGV"
FT   CDS_pept        join(complement(867756..867834),complement(867384..867659),
FT                   complement(866869..867238),complement(866520..866793),
FT                   complement(866265..866267))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198833" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877862"
FT                   /orf_name="An01g03600"
FT                   /product="Similarity to casein kinase 1 cki1p -
FT                   Schizosaccharomyces pombe"
FT                   /function="kinase activity"
FT                   /protein_id="CAK36898.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniParc:UPI0000EF9DD2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A1"
FT                   /transl_table=1
FT                   /translation="MACACGSATPFPETKKALQIGEVKHTWSNSFSPVTSPSPSKFPPL
FT                   QCYPNSNNHSNSRASIALAPEYSPQNAYIPTTQTASPPDTEPEKPNPGLANNLSSHHDV
FT                   SIAADTPLTHPQMEAHKDILCVSPYFAALCNPPNNDVSSSSPSSSPSSSPSPTESMRQI
FT                   DLPDEQPEIFSCVLEYLYRGDYYPRLRHDKTTNTWDLETTPSSSTNTRTTTNNKDTTDP
FT                   NAIIFHPAVGAEILRDTAVYCAAEKYSLEHLKRLALKKQGLHSNIPCHIILSSARYAYM
FT                   HTPDTESKLRAHYLALIIRSRGTFKRSGTMQMEMERGGKLFFDLFVAMCNHM"
FT   CDS_pept        join(complement(870114..870234),complement(869916..870043),
FT                   complement(869090..869857),complement(868987..869031),
FT                   complement(868709..868800),complement(868370..868500),
FT                   complement(868090..868208))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211399" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960194"
FT                   /orf_name="An01g03610"
FT                   /protein_id="CAK36899.1"
FT                   /db_xref="HOGENOM:HBG323884"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="UniParc:UPI0000EF9DD3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A2"
FT                   /transl_table=1
FT                   /translation="MELVQKEHDRLSKKIKAGQGIKNVQSTIDLLQSARDAIAADPSQA
FT                   SITLAKLQNPVKSSFDSINDSLKETHSGLNKYSKSLDKLFKDRPLPSTEHDVLSSQEHL
FT                   INRAIAMHLLREGQFSVASEFLNEMAQKKAMKKQQEGDIEAIDNAASLLDLDEVPPGEV
FT                   RQQFHTMYHILHELKENNNLLPAIQWSRENKEALEARGSNLEFELCRLQFVWLFYGGQH
FT                   QQGPSPGGRQAALEYGRREFHTFLPRYLREVQQLMGAMAFCPNLRDSPYNHIFNNPSAW
FT                   SDVAHSFTREFCSLLGLSADSPLYVAATAGAIALPTLLKLQTIMKAKRTEWTTENELPV
FT                   EIPLPPSYLFHSIFGQFSGYSGSQVQAHLHTAMGVGYTICKQALCDWPSPGDAIGSLHA
FT                   KLSVLKVSLCNSRKQRLLMQPVYTRTRHGATLTWMHRVSAPIAGVDGTKHAGLIRSGAF
FT                   KSPPPNFPP"
FT   ncRNA           871843..871991
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="U4"
FT                   /db_xref="Rfam:RF00015"
FT   CDS_pept        join(complement(872593..872604),complement(872452..872502),
FT                   complement(872282..872399),complement(871912..872126))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877863"
FT                   /orf_name="An01g03620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36900.1"
FT                   /db_xref="UniParc:UPI0000EF9DD4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A3"
FT                   /transl_table=1
FT                   /translation="MPGAQVSIPYRQNTGKRDTTWNTTLHLDQSILHETQLPRCIQPQL
FT                   NRSSALPQGPYGRSRGGQALFSPGLLKGGNSSEKKTNLEYYPDELTNGQQQDCLRTLNR
FT                   LQNLKAWHLFFQKFLPDPKTKESGQTR"
FT   CDS_pept        join(872971..874249,874366..875537)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211400" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654274"
FT                   /orf_name="An01g03630"
FT                   /product="Complex: S. cerevisiae STB1 "
FT                   /protein_id="CAK36901.1"
FT                   /db_xref="HOGENOM:HBG329893"
FT                   /db_xref="UniParc:UPI0000EF9DD5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A4"
FT                   /transl_table=1
FT                   /translation="MPPPATQTGGQAPPPSITPRELAKHSINTKDVQSTQLVGSEGQSP
FT                   RHGRQRLVFTDPVALRYLEEDNEADLLGRRLTLEGYEAFIVEQWACTRMHPTFIITTYT
FT                   GDPSHKVVVGVLSVPTDESRWSPRMKMYFDAVRQCQARKKETPLGTLMVTDLNEFPLAL
FT                   TLIPVPDGDVLKHKEDFIVNENLKRLGCSGRSGLKLQPPSPATEGKFHHLYRTSEKVPL
FT                   YTAVIELVKQCQIALMMFGNLAPEYVDGLLCDVTEAAINDWWTETGMDLYNIEPSDSML
FT                   GPISVAALLGTLMGARNRLHAFGAPVGKDAFDIDNLTKGIGSFQKSQKLKRTRILDRQT
FT                   LDRLHRVTAKAANAEGWTDAVKSTMAELSGHGGEMVMGMVRGREKGGIADIETLDIDNF
FT                   AHLVTGERAKWLWRGKPRKGGIDDNAQRRPPESASSLDEKDQNLGRLVRKGVSEKVSDA
FT                   RAGFGRFKDAVGLRSHPQKHSRDDIDLGGASTHLSPIDSDTEVSQSKKSDGGAPVGSVD
FT                   VQDHEGQAPKDDSQVESPPRTILPQSPKSRAPAITVETVPSQADSESSRKVSVPRTDDE
FT                   AQDLERWRTLSTDITVDPREQTSEVGIMLLRRPQSCTELNVASDSSRLDNYWPRHLSFS
FT                   TVEEVVLGWKDLGGEAFKEKPDTLLDEAIMQEDILASDARIFSSRIQELSEHTVPWVEQ
FT                   QVSSVDDLSRCLHESREKVNAAYLERLSIFEQMRARSSDLLTEEHSQLTDYMRRVELMG
FT                   AKLDYELHVLDSRVEDVETNLDEFERHVNAIENRVKLLIRGEHEKQDNSWFSWVRRLTG
FT                   CSTQ"
FT   CDS_pept        join(complement(876225..876322),complement(875920..876103))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806934"
FT                   /orf_name="An01g03640"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAK36902.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG560646"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI0000EF9DD6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A5"
FT                   /transl_table=1
FT                   /translation="MSFLFGGAPKLSSEQKIAAAETEVEMVTDMFSRLTESCIKKCIPN
FT                   DYREGDLNKGESVCIDRCVGKFFEVNMKVSEKMQGEANQKGGMGGFGM"
FT   CDS_pept        join(876674..876732,876961..877250,877310..877474,
FT                   877532..877957,878009..878826)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000236577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877864"
FT                   /orf_name="An01g03650"
FT                   /EC_number="6.1.1.6"
FT                   /function="ATP binding"
FT                   /function="lysine-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="lysyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK36903.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006430"
FT                   /db_xref="HOGENOM:HBG631383"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0000EF9DF2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A6"
FT                   /transl_table=1
FT                   /translation="MQPIRPFRASSLRVGGLLSRAGLPISRTSQAFQTSGRLARVIQHT
FT                   LAPLVQTRHNSVDAYPEKAFKRRVQLIEEAVAESYPRLASNKNTVSCAEFRGRYSHLAD
FT                   NEIVEDDTVVINGRVRTLRLVGGNLIFFDLVHDGHKIQVMCNRRRLKDIPPATFKQFYR
FT                   MLRRGDAFSVTGNPHRTERGELTVLATELPQLLSPCLHDIPVDAQGQENSPYPRHVQFL
FT                   ADPETVNVIRARSAVVQYLRQFFVDRAFMEVNTPIIEAVAGGAIARPFHTTATEFPDRQ
FT                   LSLRIAPELWLKRLVVGGFDRVFEIGPSFRNEGLDKTHNPEFTTCEFYHAYANLEDLMT
FT                   TTEQLLSGLAEHLTAFHQSSPFKRPNQEDTPLPFSHLNFSAPFRRLDFITSIEQSIGQK
FT                   LPDLASPDALEQVKAIFRDRNHALPDKVTLPRLLDELCSIYVEPQCIDPTFIVNPPECL
FT                   SPLSKSFIHPTTNQRVAARGELFIEGREVVNTYEEENSPFEQRRKFEDQVRYSKQADEA
FT                   EEIDESYLKALEWGLPPTGGWGCGIDRLCMLFTGMTRIGDILPFGNLRKVTTRADAAAE
FT                   SQATEGKEN"
FT   CDS_pept        join(879331..879394,879508..880267,880371..880395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211212" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960195"
FT                   /orf_name="An01g03660"
FT                   /product="Similarity: the ORF shows strong similarity to
FT                   EST 5419 - Aspergillus oryzae"
FT                   /protein_id="CAK36904.1"
FT                   /db_xref="HOGENOM:HBG398232"
FT                   /db_xref="UniParc:UPI0000EF9DF3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A7"
FT                   /transl_table=1
FT                   /translation="MALDDIPVAQAVTVSLQELIDGTISPQTLTAAFGPFSLGIILVKD
FT                   LPPTFSHLRAQVLSNASYLASLPPSALDSLTCPSAKYLIGWSLGKETLRDGHYDTHKGS
FT                   YYLNCAFYKDPSLQGAPSIDTEFPEYTSPNIWPSETDLPTFRSSFEQLCTLIIDTAALV
FT                   ARACDRFAVESVDGYKDGYLEKVVRGSFTTKARLLHYFPTEDSSSSTESTGGEEGAEDN
FT                   DDDWCATHLDHGCLTGLTSAMFVDEEAHDPSSLEDKSAPLPELTTSPDPKAGFSALCRI
FT                   S"
FT   CDS_pept        join(complement(883177..883369),complement(882608..882883),
FT                   complement(880623..882541))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211201" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654275"
FT                   /orf_name="An01g03670"
FT                   /product="Similarity: the similarities are mainly due to
FT                   repetetive sequences"
FT                   /function="binding"
FT                   /protein_id="CAK36905.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG329894"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR018839"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI0000EF9DF4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A8"
FT                   /transl_table=1
FT                   /translation="MSVIMQDSSASDQQKMVVIPINRAFSDGTQDNWPKDERFLRPDDS
FT                   YYREKLASMWLQKTGAYERGVEYILDSLPDGYALFDRPRMANPDIVGFSRSTPKRIHIP
FT                   NSLQYDRFLYGHPTDVYFNSTKQFFPHFYYLMTGGQEPCACVLCEKMSKRLQEKRGPGR
FT                   PRGRPSGTGTLIRTPGRPPGRPPGRPPGSSASKTPGRPPGRPPGRPGRPPGRPPGRPPG
FT                   RPPGKLSGSATCPCTDNEGTPDVFKMAVLQLELKGLQETDITEPGSMDWRAERSPLDEY
FT                   IQKLDLQPSFLPRAGEIVLWTPDFEGELAWNPENNQIQIYFPSEKRWLGTPEWRAGIVS
FT                   QVPEEDTIFQDIVQTSPKEQSINYSGFRVETFPDPHSPDKSYSLHYKYVYLKSIKPFNA
FT                   YEHFLQNIPRENLHPSIEYAMTIMSSFSLLDKYHFKGVWPDASIYSRGIFIGAELLTVG
FT                   DAVRLKPQNYNLNSPHSTPNPAVTDIMVIDEIRLDLKNCDSALRSKHLAEKYIVRIRGK
FT                   VYTPSDRRIYLSSNTLHPIKPLTPDEVVSAFNYVGMSGYGDWYRMHPGASVDISQDMIL
FT                   GRLYEPDALQLMFGSLALGYDLQGVLRGRVYSRQADERIPEGQKWFWGDFRTQTLAIDS
FT                   LNGEDVGHYSDARDVKMWRANLRVLDGVARPADFREAKIPGDVGRPSTKSRSNFAKVGK
FT                   LSKLVSTGLGSADLSNPVSEAEEGTSRLSVGDDDEEEEEEEEEEEEEEEEEEEEEEESE
FT                   EEEEDFTLRMDQLRGGTEETEEGNYMPDKERERERKRVRHDD"
FT   CDS_pept        complement(883834..886290)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960196"
FT                   /orf_name="An01g03680"
FT                   /product="Complex: mouse ALDR must form a homo- or
FT                   heterodimer to be functional"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /biological_process="transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK36906.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0000EF9DF5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A9"
FT                   /transl_table=1
FT                   /translation="MAAHSTLRRREDPLVALYNKYASLVRSRIKRSSKTTQIIATIALI
FT                   LSILGSGYGGYKWFRERAKERARGRQLLRRNSGIRGKDGTRTIYVPYKGSMTSKVVIHP
FT                   TKQTTFDAHRRLFLNPPAAARVGDGESVNQIPPPTTKPGINLAFLHQFLSLGSIMVPRW
FT                   GSKETGLLMGHGVFLLLRTYLSLLIARLDGEIVRDLVAGKGRAFAWGILKWCGIGTLAS
FT                   YTNAMIKFLQSKVSIAFRTRLTRYIHDLYLTGDNNYYKLMNLDGGVGQGPDQFITQDLT
FT                   LFCSAAAALYSSMGKPMVDLFVFNYQLYRSLGPLALTGILTGYFSTAAVLRKLSPPFGK
FT                   LKAVEGKKEGDFRGLHSRLLANAEEISFYGGADIERVFLMRSFKDLQRWMEGIYSLKIR
FT                   YNMLEDVILKYAWSAFGYLITSLPIFLPAWGGMGGALELVDVPKETGRERDRMKEFITN
FT                   KRLMLSLADAGGRMMYSIKDISELAGYTSRVYSLISTLHRVHASAYYPPRNSHAELYSL
FT                   ADVQGTIHNGFDGVRLEQVPIVAPSIYPRGGDDLIESLSFVVHSGDHLLISGPNGVGKT
FT                   AIARVVSGLWPVYRGLVSRPRGFGLDGIMFLPQRPYLSVGTLRDQVIYPHTAVDMHEAG
FT                   ITDAALQKILDDAHLGYLPGREGGWDTRKEWKDVLSGGEKQRMALARIYYHEPRYAFLD
FT                   EGTSAVSSDVEGLLYQRAKERGITVITISTRASLKKYHTYNLSISIGEEGEQWEFERIG
FT                   TAKEKLGVEKELQEIRKRLDKVEEWKQRREEIENELRKVWVEEGELAPPPYGSESEAVE
FT                   VQDDQQ"
FT   CDS_pept        join(complement(890889..891291),complement(890759..890792),
FT                   complement(890338..890436),complement(890192..890224),
FT                   complement(889678..889744),complement(889420..889632),
FT                   complement(889219..889332),complement(889031..889123))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111058"
FT                   /orf_name="An01g03690"
FT                   /product="Similarity to toxin subunit 1 TOX S1 -Bordetella
FT                   pertussis"
FT                   /protein_id="CAK36907.1"
FT                   /db_xref="UniParc:UPI0000EF9DF6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B0"
FT                   /transl_table=1
FT                   /translation="MTTRVTAEKGREGGCAGKEDEERERGCSHASWLFARTEWMGWRQV
FT                   TKVVVPVSCLALGPGPPPGIRLVRSTKKNSFAMSRSNQSALQCPEYTGRQTSIKAYATG
FT                   TIWRSSLGMIAGMEGFERVKCRLFESRGSRGKGHRSDSPVDGRDERQGSTEVKGNQPRC
FT                   GGVLMWSSKPVDDSGEELAEEYAEPEGAAELGPDTLRTATTGWSSIGTEMPRTLKFARP
FT                   DYPPLEPVNHYEVCRTNLSLPAPMVMVNHAPQRIQINYYCTDMWMIRIPAGSPILHLIQ
FT                   TDPSTRGHPEHVPTREQAYAVLCSSRTQLEISPKLGEVMKGPCSSFIPRALLGRIGGSQ
FT                   ESRWSQPPLTR"
FT   CDS_pept        join(891411..891510,891608..892803,892855..893004,
FT                   893060..893158,893216..893428)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211190" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877865"
FT                   /orf_name="An01g03700"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAK36908.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG329897"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000EF9DF7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B1"
FT                   /transl_table=1
FT                   /translation="MLGGSLERDSSPSNSKPTTGEAPMPIATSPPDSNPEPSPQDQPAT
FT                   TDASPLSNNVEPTNAAQESVAPAQGSVDESAATSADAPKKHHLLLPISSRASLKADRQS
FT                   TLDKSQDTAHDDSENTLRGSKRSIFKGRRDRSRGSSMRSRRQNQEGASMEEDKSASPDL
FT                   RDPAKPERRSKVSYRLFAFLSCCSSPSDDSEDPAIPVKRTSRQPSVPHTQATPEKADAN
FT                   AGDSSTAESKDPSYYRDEKPNMTVTSNQSMSQVDEERTVTTSEQGAQLDGATVPSGPAE
FT                   TEKVPALPQDSADSQGLGVGQSTQPSTTTAEASAVASEAEEPSQKTEEQIISTSTEKAQ
FT                   DTPTAPIELDELPKPPASENSYDDEKYTSHDEEATVLPAELPPPTGPSGHHVDTMLEET
FT                   QQQFLLPPPLPHLRDRKCLVLDLDETLVHSSFKVLERADFTIPVEIEGQYHNIYVIKRP
FT                   GVDQFMKRVGELYEVVVFTASVSKYGDPLLDQLDIHNVVHHRLFRDSCYNHQGNYVKDL
FT                   SQVGRDLRDTIIIDNSPTSYIFHPQHAIPISSWFSDAHDNELLDLIPVLEDLAGAQVKD
FT                   VSLVLDIAL"
FT   CDS_pept        join(complement(893881..893938),complement(893684..893850))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877866"
FT                   /orf_name="An01g03710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36909.1"
FT                   /db_xref="UniParc:UPI0000EF9DF8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B2"
FT                   /transl_table=1
FT                   /translation="METMKGTKSRKRQMKEKRESKFWLMTKTDACGMQQERKLQTLGNK
FT                   TGGGNLVSARWERKNMAGARKKNGASDMG"
FT   CDS_pept        join(894763..894898,894993..895024,895101..895172,
FT                   895242..895538,895595..895669,895738..896140,8
FT                   96201..896220)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111059"
FT                   /orf_name="An01g03720"
FT                   /protein_id="CAK36910.1"
FT                   /db_xref="HOGENOM:HBG526095"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI0000EF9DF9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B3"
FT                   /transl_table=1
FT                   /translation="MKDKNGWDGKLRVEPKATITNPEALEDPDYSDSDAPPVEEIEADE
FT                   DLLEDEDPDAEEIDLVHCRITSIPALRLERFPKVKRLCFRQNQISRIEFPTEVAKSLTE
FT                   LDLYDNLISHVKGLDEFENLTSLDLSFNKIKHVKNISHLVKLTDLYFVQNKISKIEGVE
FT                   TFTSLRNLELGANRIREIENLDNLKALEELWLGKNKITELKNLDGLSNLRILSIQSNRL
FT                   TKISGLANLKNLEELYVSHNAITDLSGLEENTSLRVLDFSNNQVSKLEHLSHLKNLEEL
FT                   WASNNQLSSFDEVERELRDKENLQTVYFEGNPLQTRAPALYRNKVRLAIPHIMQVDATY
FT                   IRVV"
FT   CDS_pept        join(complement(897070..897201),complement(896438..896995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211168" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111060"
FT                   /orf_name="An01g03730"
FT                   /product="Remark: the gene model was extracted to fill an
FT                   intergenic region"
FT                   /protein_id="CAK36911.1"
FT                   /db_xref="HOGENOM:HBG329899"
FT                   /db_xref="UniParc:UPI0000EF9DFA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B4"
FT                   /transl_table=1
FT                   /translation="MTLKPLTSSIHIKTHPAPRSLSESKLILSALQKFGEVVTFRNLKY
FT                   DPTNTSPKSAHNTIAIFESASAASSAIAASPISIPIQNQTQTQTQTQTQTQSQDESPSN
FT                   ANHTASPATQSQETTQQPHTLTCTIQPSRHNHVSAMTRNPYHTFFYVDKESHMYKDLVK
FT                   SGIPLDYLADGPMRRKAHVPERVKRMLDRDVWRFGGKSLMGLYRFGMESENGKESGNGD
FT                   GEDEGTK"
FT   CDS_pept        join(complement(898393..898537),complement(897544..898331),
FT                   complement(897456..897482))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877867"
FT                   /gene_name="xyl1"
FT                   /gene_synonym="xyrA"
FT                   /orf_name="An01g03740"
FT                   /product="Probable NAD(P)H-dependent D-xylose reductase
FT                   xyl1"
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="D-xylose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK36912.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0042732"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000006C233"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8B5"
FT                   /transl_table=1
FT                   /translation="MASPTVKLNSGYDMPLVGFGLWKVNNDTCADQIYHAIKEGYRLFD
FT                   GACDYGNEVEAGQGIARAIKDGLVKREELFIVSKLWNSFHDGDRVEPICRKQLADWGID
FT                   YFDLYIVHFPISLKYVDPAVRYPPGWKSEKDELEFGNATIQETWTAMESLVDKKLARSI
FT                   GISNFSAQLVMDLLRYARIRPATLQIEHHPYLTQTRLVEYAQKEGLTVTAYSSFGPLSF
FT                   LELSVQNAVDSPPLFEHQLVKSIAEKHGRTPAQVLLRWATQRGIAVIPKSNNPQRLKQN
FT                   LDVTGWNLEEEEIKAISGLDRGLRFNDPLGYGLYAPIF"
FT   CDS_pept        join(complement(901115..901553),complement(900885..901061),
FT                   complement(899081..900828))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211157" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877868"
FT                   /orf_name="An01g03750"
FT                   /product="Function: A. nidulans brlA "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36913.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG329900"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="UniParc:UPI0000EF9DFB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B6"
FT                   /transl_table=1
FT                   /translation="MAHWQTGCIVPQHQSALESIGAHTDRALQNTSGNVQTYSDNLADS
FT                   STVGRDDQLQQLAFKYPQPPVPTHPVPTVPTTLQPPQNLRLQSKKLRRLHLSGPSLIGP
FT                   RSRPRSYLRSSKYLEYRSRPRRDTGKDGEPVWSDELEDAFQQALEANPPMGRRKWSERG
FT                   KSYGRNELIAEFIYKKTGKRRTRKQVSSHLQVLDSFLKGDPDWERLVREEANVRSNNQH
FT                   PPAGPRWGPAMDPPLSSHYGTHLHPTYHDPMRQAYGGDLPPTPFSMNASWPESNFSTIQ
FT                   GLGFGMWVNEPDKNDRIEDASHIYSRLQDDQRHPVAPISLNEIRNWQTSFPYLNSLMAN
FT                   SNGSLDCDIILIEANLKLMDDFPAARSKLGIHLELDFAQASAAGVPILSEMENWSSKIY
FT                   MYENGQEIYQGRQEVARPVHTATHTKVKPHFESKWWANRFTKLTQDQKMAEDAGHHGHE
FT                   QAREFLRHLTVVQEIRAMAPYSSRRMSNPYSGHAVSEKKRVAIILWKFRQTLPRDVVGT
FT                   TTWRRVVSSDRIPHASPKAATGIDLPPPMSLADSILLNRPGPSVYHQPQSHELLHNHGV
FT                   SQNPWPLYSTGQESVAQMFNAPFDFMSPLKQEDRLNDKIAVTLGLDAFPSLQSHDINQQ
FT                   TSLNGPNSGTSILSMSEVPLSHSTHGPYSLEHDSHYVHSQPLGVNVHDNNALLNGMLVT
FT                   SAQSIDDINNSQASWMPPTTAMSGDIPGSHYPHMGYPSSEHHVAVPREPNPSHSYDFMP
FT                   EELDKWPGSLPTDMNGGAHEHAHSYTASNTVQAV"
FT   CDS_pept        join(complement(905144..905371),complement(904290..905048),
FT                   complement(903805..904077),complement(902537..903754))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877869"
FT                   /orf_name="An01g03760"
FT                   /product="Similarity: the presence of RNA binding domains
FT                   suggests a role in RNA processing "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK36914.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG412223"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EF9DFC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B7"
FT                   /transl_table=1
FT                   /translation="MESTRVFVSGLPPTLSDDQLRKHFATRFQVTDAHVLPKRRIGFVG
FT                   FKSHEVAQQAVSYFNKTYVKMSKISVDIAKPIDAEPTRKAGKHDKSSASNAADTSLKRK
FT                   RDGENAPQDARLQEYLSVMQHSSKTKTWANDDVPKPPENDSPAEQPAEVEEQPQELTYA
FT                   QRKKAKLGEEYDHSKEMHTADREAHGSPEPMVVDHSGEGNAEAPAEQDDTVAEAEAPAV
FT                   SDADWLRSKTSRLLGLLDEEEQADFDAAAQQKESAAPEEAEDPGADSRDAQIVAPAATE
FT                   DKTVQEPQVDTNIENIRLSARLFVRNLAYDTSESDLEPLFAPFGRIEEIHVAFDTRVNT
FT                   SKGFAYIQYLDADAAVEAYKNLDGKHFQGRLMHILPAAAKKTYKIDDAELAKLPLKKQK
FT                   QIKKKMDASSSTFSWNSLYMNTDAVMSSVAERLGVSKADLLDPTSSDAAVKQAHAETHV
FT                   IQETKAYFSANGVNIEAFKQRERGNTAILVKNFSYGVKTDELRKMFEPFGQITRLLMPP
FT                   SGTIAIVEFSRPDEAQKAFKGLAYRKLGDSILFLEKAPKDLFDAAVVPQKATIETKAVS
FT                   QGFSTADTFAADEVDDLTPTTTLFVKNLNFATTNQSFVDLFRPLDGFVSAKIKTKPDPK
FT                   HPGQTLSMGFGFVEFRSKAQAQSALAAMNGYKLDQHELVVRVSHRGMDAAEERRREDTA
FT                   KKVAARRTKIIIKNLPFQATKKDVRSLFGAYGQLRSVRVPQKFDRSARGFGFADFVSAR
FT                   EAENAMDALKNTHLLGRKLVLEFANEEAIDAEEEIKQIEKKVGEQMDRVKLQKLAGPGR
FT                   KKFTVGAQDGEED"
FT   CDS_pept        join(905661..905691,905743..905765,905816..905849,
FT                   905903..905937,905983..906009,906062..906131,9
FT                   06181..906245)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806935"
FT                   /orf_name="An01g03770"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="microtubule associated complex "
FT                   /protein_id="CAK36915.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005875"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="HOGENOM:HBG627578"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="InterPro:IPR019763"
FT                   /db_xref="UniParc:UPI0000EF9DFD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B8"
FT                   /transl_table=1
FT                   /translation="MASEKKDKLEAQIKSVDMTEDMQQEAVEVAIEAMDKYHIEKDIAQ
FT                   YIKREFDSRKGATWHCVVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ"
FT   CDS_pept        join(906588..906885,907186..907219,907295..907319,
FT                   907377..907409,907475..907515,907584..907776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877870"
FT                   /orf_name="An01g03780"
FT                   /protein_id="CAK36916.1"
FT                   /db_xref="UniParc:UPI0000EF9DFE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8B9"
FT                   /transl_table=1
FT                   /translation="MGPQQLTTPPSAERQVPNRAKPQRHTSAPISLLYGCLPLPITWAA
FT                   ANVVLLHVALHDPTRSRFLSFITSLVRIYQPTRCLSWEHSKAVNMAICITFGTHGQHWN
FT                   GHCLTRWPWFTVCFIPVIPLATHKYKEVTCYTCRFTQDLRDRPDITPDTRPPPGVVPGQ
FT                   LPQAYYGGGAPFYPPQQASGPPPQASGGVVAPQQQAEQQNHVYK"
FT   CDS_pept        join(complement(910281..910402),complement(910025..910197),
FT                   complement(909455..909971),complement(908748..909401),
FT                   complement(908116..908692))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806936"
FT                   /orf_name="An01g03790"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK36917.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG397209"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniParc:UPI0000EF9E10"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C0"
FT                   /transl_table=1
FT                   /translation="MSSDTVTFTAPLSQGFGYGIIIGLGFAFALLMIFITWALKRYQNE
FT                   VQTSEMFSTAGRSVKSGLVAAAVVSSWTWAATLLQSTTVAYEYGISGPFFYASGATVQI
FT                   ILFATLAIELKRRAPNAHTFLEALRARYGTVVHVVFIVFCLMTNILVTAMLLTGGSAVL
FT                   TSLTGVNTVAACFLLPIGVVLYTLFGGIKATFITDYLHTVVIIVVIFIFAFSAYATSDK
FT                   LGSPGAVYDALVAASKLHPVDGNAEGSYLTMRSKEGGIFWIINLVGNFGTVFLDNGYYN
FT                   KAIAASPVHAFPGYVIGGLCWFAIPWLCASTLGMTALSLEGTQRLSPDDVTAGLVLPFA
FT                   AVKLLGYSGAVCTTIMIFMAVTSAFSAQLIAVSSIFTYDIYQAYIDPSAKGKRLVWVSH
FT                   MTCVFWAIAMAGFSTGLYYAGIGMGYLYLLMGVIISSAVFPGAMSLIWKHQNWIAAAAS
FT                   PPLGLAVSFIAWLVTTKKQYGILTVTTTGANYPMLAGNVAALLSPVIFSPILTLIFGSQ
FT                   NYDYGTMRAIRRVDDADVAAAAHIDIELIPGEINTQSAAQEEEETRKLNRAALYSRTLT
FT                   IFMVLCFLILWPIPMYGSSYVFSKKFFTGWVVVGLIWLFCTTFGVVIFPLYEGRESIVR
FT                   TVRMMALDIMGKRGRRKGMIVGEMTSGDVSGVQTPVPEKKEVLEK"
FT   CDS_pept        join(910576..910662,910827..911120,911202..911258)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877871"
FT                   /orf_name="An01g03800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36918.1"
FT                   /db_xref="UniParc:UPI0000EF9E11"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C1"
FT                   /transl_table=1
FT                   /translation="MTTDPISLDPRSQAWGSEWLIRTTPGGRFPNPRWVINVSSPDSLL
FT                   ARRKCFLSAEVSATTPIGPSRERTMIRNRRLSDKEVSQVMDWFVGAACRSAKSSMALWG
FT                   ADLMIALYQLLHYLLDPATNALGEPTDLALHLRYARSQYCA"
FT   CDS_pept        911778..912692
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654276"
FT                   /orf_name="An01g03810"
FT                   /product="Similarity: the HIT"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK36919.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG329903"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniParc:UPI0000EF9E12"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C2"
FT                   /transl_table=1
FT                   /translation="MTTKIYHTNNLTISLSHHPTTPGHTIATLTNTTTPKTTLFALPKS
FT                   TFISTLVTLRTIIPSLKSTYHTPRIALITSGNTTLSLLPLHGLTSTWTPITSPETTFND
FT                   PQSSSHPQSYITSKSGPRMPSAHLTHIADIITTHTPSTPNYTFHGPSSDTNLFANIIRG
FT                   TEHPQWRIWEDESRVAFLTPYPNTPGFTVLVPRTHLGSDIFALGEEDFEGLMGAAWTVG
FT                   RVLMEALGVGRCGMVFEGLEVDYAHVKLVPVYGDGEDDGGEREVFREVYPGYVSSLPGP
FT                   EVGDVGELVRRAGEIRQLIAAQE"
FT   CDS_pept        join(complement(913743..913745),complement(913258..913603),
FT                   complement(913162..913196))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877872"
FT                   /orf_name="An01g03820"
FT                   /product="Complex: SBH2 of cerevisiae interacts with SSH1
FT                   and SSS1"
FT                   /protein_id="CAK36920.1"
FT                   /db_xref="HOGENOM:HBG749385"
FT                   /db_xref="InterPro:IPR005609"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="UniParc:UPI0000EF9E13"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C3"
FT                   /transl_table=1
FT                   /translation="MASPRAASPMTSGAESGPDSKSAGAGTGASAVSSVNRPSSPTPPG
FT                   GPRAAMRRRAAADHKESLRNARPSSTRAAGAGGSSGTMLKLYTDESPGLRVDPVVVLVL
FT                   SLGFIFSVVGLHVIAKITRKFSS"
FT   tRNA            914047..914118
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        join(complement(915057..915097),complement(914652..914848),
FT                   complement(914422..914539),complement(914167..914320))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111061"
FT                   /orf_name="An01g03840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36921.1"
FT                   /db_xref="UniParc:UPI0000EF9E14"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C4"
FT                   /transl_table=1
FT                   /translation="MYASTSTNAVLKPRSHSGLSEVMTLKGCLLYALQLHSSSASGEPV
FT                   LIGRHVRRTLPTAVASMWLPASGSGMASMGRISAGTRIGLVVLPLLAVDYPCLKHHFVG
FT                   ADLPDCGVESRSNPSEGLRDSWASGASEPRFVVDQSTLWLIEIRNNDNYTTLAIRKNQV
FT                   QKGTSH"
FT   mat_peptide     join(complement(914652..914763),complement(914422..914539),
FT                   complement(914170..914320))
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C4 "
FT   sig_peptide     join(complement(915057..915097),complement(914764..914848))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C4 "
FT   CDS_pept        join(915404..915443,915645..915690,915734..915908,
FT                   916010..916060)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111062"
FT                   /orf_name="An01g03850"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36922.1"
FT                   /db_xref="UniParc:UPI0000EF9E15"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C5"
FT                   /transl_table=1
FT                   /translation="MQRLPCTQSDTAHLEWLPKTSSSYGVDLSYGEVYGSDSKASHGGH
FT                   ISLQNVVDMDDSHVDRFSNILPSYSYGSPAVSDPCLPILDFLFFDRSDNLEYQGNPIG"
FT   CDS_pept        join(complement(917669..917715),complement(917509..917586),
FT                   complement(917378..917464),complement(917118..917245),
FT                   complement(916898..917019))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877873"
FT                   /orf_name="An01g03860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36923.1"
FT                   /db_xref="UniParc:UPI0000EF9E16"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C6"
FT                   /transl_table=1
FT                   /translation="MSGGGVQEVGVLEDDGGICARRMARCRVKEEDGKSRGDAVGLLSP
FT                   MIDGSGLEEVCWRKAEHLRTQNRSPEKYECERWKRKAGRRTIEDDGWNGSERARDRGKT
FT                   EAAVKLSPRCVCGIQGSAGSPDTAMEGKKREKAAMITKIRGGLDDALED"
FT   CDS_pept        join(918028..918110,918180..918618,918671..918865,
FT                   918920..919210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877874"
FT                   /orf_name="An01g03870"
FT                   /product="Similarity to hypothetical protein SPAC23H3.04 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK36924.1"
FT                   /db_xref="HOGENOM:HBG329907"
FT                   /db_xref="UniParc:UPI0000EF9E17"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C7"
FT                   /transl_table=1
FT                   /translation="MYRPNSLWTWSFCIVTLIQTIITLALESYVFANFQIQLFPKGEVS
FT                   TASKTVTTFLALYCFGFIYELILVYDALRLKNTIQVIGLCVCNLGLLIYGAVQVQQIKD
FT                   SIEMLVAESAITIDVWGETEPFLIIIPCVVAMGSILMMIIAWKLYDEFAWSIYKHISAD
FT                   LRMKRRYLTYQIYIALLKFDFFFFLGFTVQFLVIVTNKTDVEFALTTAAIPVTILILVC
FT                   AAIFVKRESSIGMIVVILLYFAAMAYFLFKLVRMYQPQTYQEYLPARRSLTFFAVITLL
FT                   LIVLTITNACVCMHNFHKGLKQHVHKKKSRDKDEKTTELSSNISGQVPNRMMID"
FT   CDS_pept        919462..919611
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960197"
FT                   /orf_name="An01g03880"
FT                   /product="Similarity to EST an_1234 -Aspergillus niger "
FT                   /protein_id="CAK36925.1"
FT                   /db_xref="UniParc:UPI0000EF9E18"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C8"
FT                   /transl_table=1
FT                   /translation="MIPPTALLGFFLRTFDCLSLLISSEFCLKWLFTLPASRSCSMTRR
FT                   VASH"
FT   sig_peptide     919462..919518
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C8 "
FT   mat_peptide     919519..919608
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C8 "
FT   tRNA            complement(919993..920064)
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        join(complement(922328..925138),complement(920827..922080))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877875"
FT                   /orf_name="An01g03900"
FT                   /product="Function: AtrA of A. nidulans is an ABC
FT                   transporter"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK36926.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0000EF9E19"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C9"
FT                   /transl_table=1
FT                   /translation="MEEKVASAHDPYPSDKEQTPSLDEEEQELHNLTRIASSRTGRRIS
FT                   HAATINEKDDPRLDPTNPAFDQRLWAKLVLRALDQSGIVQQTQGVVFSNLCVSGSGSSL
FT                   QIQNTISTQLAAPFRAAARALSGRASPPPRQILHGFDGFLKSGELLLVLGRPGSGCTTF
FT                   LKTLCGHLGGLTLEPQSTIHYQGIEYEDMIKHHRGEVAYNKEVDQHFPHLTVGETLSFA
FT                   AHARTPQKRIEGLTRSEYVETLTQVVLAVFGLSNTYYTKVGDNFVRGVSGGERKRVSIA
FT                   EMFVSRCRIGAWDNSTRGLDASSALKFVRALRIAADMGRSCHAIAAYQASQSMYDLVDK
FT                   VVVLYEGREIYFGHRDRAVPYFEEMGWELPDRQVSGDFLTSITNPGERKARPDMVDKVP
FT                   RTAKEFEEYWKRSPEYKELCGQIEEYQRAHPPDSDEAKAFKAHHEEQQARHTRPRSPYL
FT                   LSVPMQVRLCLRRAFQRLRNDLPTVIVTVATQPILGLVIGSIFFNSPPTTATFFQKGAV
FT                   LYFAVLFNALIALNEIIQLYSQRPIAVKQAGYAFVHPFAEALASWIMDLPIKFTRGTLF
FT                   CVILYLMSNLRREPSQFFICYMFLLTSVLTMSGIFRSLAAATRTSAQAMSMAGVCILCI
FT                   VVYTGFVLPQAYMHPWLSWIRWVNPIYYVYEALLANEFHGRNFECASVIPSYATGSSFI
FT                   CSTVGAVAGERFVSGDAYVEQNYQYYYSHVWRNYGILVAYLVFFTGLYLFLSEYNSGET
FT                   SKAETLVFRSGHVPQYLLSSDGIEDGEAPPDKPEVGDQVDAISLPQQTDVLSWKGLNYD
FT                   IPVKDGTRRLLDNVNGWVKPGTLTALMGVSGAGKTTLLDVLAQRVSIGVVTGDVLVNGR
FT                   ALQANFPRETGYVQQQDLHMETTTVREALRFSAMLRQPASVSEKEKYEYVEEVIKVLRM
FT                   QDFAEAVTKGGKTVYFGDIGDQSRILLDYFERSGIRRCGDMENPAEYILEVVAGEGSEG
FT                   IDWVQRWNDSPERKEVLAELERLQDPQQQPEPRAQDGDSNNSEFAMPFTSQLYHVMKRA
FT                   FQQYYRQPEYVFAKYSLGIACGLFIGFSFFKANNTQQGFQCALFSVFLLATVFTTLVNQ
FT                   ITPRFVAQRALYEVRERPSRVYSWKVFILSNVLVEIPYHIVLGVFVWLSFYWAVMGTGQ
FT                   DAERHVLGLLYIVQFYLYVASMAHFVIAAVPQAPVAGILAVLMFAFAFIFNGMLQPPGD
FT                   LPGFWIFMYRVSPFTYYTAGVGSSILHGRPVECSATELSVFDPPSNYTCGQYMQKYVEA
FT                   AGGQVYNPNATSACEYCSMTVADEYLALRWVYWKDRWRDYGIFWCYFVFNIAGAVMLYY
FT                   FFRVKKWGKGK"
FT   CDS_pept        join(complement(926270..926482),complement(926033..926182))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806937"
FT                   /orf_name="An01g03910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36927.1"
FT                   /db_xref="UniParc:UPI0000EF9E1A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D0"
FT                   /transl_table=1
FT                   /translation="MARKHCEYTITYGYGRSNNLQQGEFEIKHKELLNEVFIHSTALWN
FT                   VSFTARYLLITRVFICGTAIPNPRRPPKWIPYRGLIVDHRRVGGPISRDRVGGLGVASR
FT                   QYFPSLLSLGPGTTPA"
FT   CDS_pept        join(926586..926709,926933..926998,927195..927263,
FT                   927341..927447)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806938"
FT                   /orf_name="An01g03920"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36928.1"
FT                   /db_xref="UniParc:UPI0000EF9E1B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D1"
FT                   /transl_table=1
FT                   /translation="MPGISFLLSSGVHWRWLEARNGLPCSVYYDVQMEKGLQPSKAYAL
FT                   GPQHRTLELDGVIQNHARGWVGPEGLISRSRSCFAASGWLKGQEVRTVLSDRLAMSTDA
FT                   AKATVTSEVIQKVTHKK"
FT   sig_peptide     926586..926642
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D1 "
FT   mat_peptide     join(926643..926709,926933..926998,927195..927263,
FT                   927341..927444)
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D1 "
FT   CDS_pept        join(complement(930307..930322),complement(929684..929890),
FT                   complement(929590..929630),complement(929092..929521),
FT                   complement(928752..929038),complement(928678..928695))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877876"
FT                   /orf_name="An01g03930"
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="CAK36929.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG749295"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniParc:UPI0000EF9E1C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D2"
FT                   /transl_table=1
FT                   /translation="MCLVVSPSINSPQPERHAVILPTHSIPSVSSLRFPIFTILLSPAN
FT                   HHLLISASPLSSTSPSNQLLTVLTYHHIKMLEARLEQASLLKRVVDAIKDLVQDCNFDC
FT                   NDSGISLQAMDNSHVALVSMMLKAEGFSPYRCDRNIALGINLLSLTKVLRAAQNEDILT
FT                   LKAEDSPDAVNLMFESAETDRLSEYDIKLMDIDQEHLAIPETEYAATVEMPAAEFQRIC
FT                   RDLNALSESVVIEATKEGVKFSCQGDIGSGSVTVRQHTNVENPAQNVSISLTEPVALTF
FT                   SLKYLVNFCKATNLSNKVTLCLSQEVPLLVEYGLGSGHLRFYLAPKIGDEE"
FT   CDS_pept        join(930778..930794,930868..930907,930951..931074,
FT                   931133..931296,931339..931468,931533..932035)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142393" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877877"
FT                   /orf_name="An01g03940"
FT                   /product="Similarity to hypothetical protein EAA64320.1 -
FT                   Aspergillus nidulans"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK36930.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG532399"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9E1D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D3"
FT                   /transl_table=1
FT                   /translation="MTTVFITGASGYIGGDLLSSEAATAARKIKAQYPTVEIIQGSLDD
FT                   SETLVAESARADIIIPDFTGMKDTADAADHLGAAKAIAQGALEGHTEEHPVYWLHTSGA
FT                   GIFSFLDTETKDIKEIVNFPDHAFHRDVDKAVFEAGSVRPEVLKTAIISPVTVYGQGRG
FT                   PCSQRSRQIYELAKLTIQRQKVPIIGRGLSFGTDIHIYDLTNLYVILFERALSKQDDGL
FT                   WGPEAYYLCENGEHCWGELARSIGRICVAEGFIPSAEEEAFGFEEAQKWAGYEAASWGL
FT                   NSRCRASRARLLLGWQPSAPSLESELRDIVKGEYRRLQEAERDA"
FT   CDS_pept        join(complement(934711..934759),complement(934450..934649),
FT                   complement(933907..934388),complement(933400..933851),
FT                   complement(932684..933348))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211077" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877878"
FT                   /orf_name="An01g03950"
FT                   /product="Similarity to hypothetical protein CAE76289.1 -
FT                   Neurospora crassa"
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="CAK36931.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG329912"
FT                   /db_xref="UniParc:UPI0000EF9E1E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D4"
FT                   /transl_table=1
FT                   /translation="MESLVYENSPLADYLQGEGEHDPSWPVKEADHSDDFSDSTAADFA
FT                   PRGVSKFQERIRNKLPKPLERKVSRQRAALGRLYDVCTSALNSRVGRSDNERFLEQFGY
FT                   VIVASQLLNEHSAPSYTSAADVMSTALPADLPSISTTFGIQGAVVTASTSFSVAWLLHW
FT                   SRSRTSSGLNPRKVGVLLVLVPVIGVLFYAFAKRQWLKYLRHQAVDAAVTFISNAQGFD
FT                   SAASASVVFIQEVELVSRGYRISTPLPPVSRLEDQTQTRRCLRLRRTVSESFYLMLGQY
FT                   IRAQHTLRPLTDATNLAKYYDIYDISEEELMEAEAAFDERATEDQYSLRALRTLFGRLY
FT                   IVRKSILCCLLALGADGGGSDIARWTTAVEQMRDLAHVTGENIHKMTNILNEDDRDVIP
FT                   PSPLPTASPNKDNLRAQYRNINSLSQGIRALHAKMHILKEASSSNLERPDAGEFEASLM
FT                   PQYESIGADIRSLLQEWESGKSALMSSLGKPANPEFSRPSSFLKTPLSPTPSLGGSTAV
FT                   EGSPADALRALTGENTDPSIVHTLDDEEEIFEAVALPARNKRMSLTREERIARVKEDRA
FT                   RQAAARERTDANTNMLKELEMVIKQRPRTTIAAKRVTSI"
FT   CDS_pept        join(complement(935655..935718),complement(935412..935610),
FT                   complement(935166..935322))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960198"
FT                   /orf_name="An01g03960"
FT                   /product="Similarity to hypothetical kinesin-like protein
FT                   klp-7 - Caenorhabditis elegans"
FT                   /protein_id="CAK36932.1"
FT                   /db_xref="UniParc:UPI0000EF9E1F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D5"
FT                   /transl_table=1
FT                   /translation="MVTSEIPRGLQHMLDAETSVCRESQSTDLDHPLANLCDHRLNPLG
FT                   SLGCTPSRALTGWKTRLAVPWRNNPPDRIEANDSHKGKSPPKRKRQLRFEQKREAQAIQ
FT                   FPRHTHGLIFNVAAAQAPSFGLPLCSLTSVSICQG"
FT   CDS_pept        join(936758..938787,938833..939688)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877879"
FT                   /orf_name="An01g03970"
FT                   /product="Similarity: the C-terminal part shows strong
FT                   similarity to D. melanogaster asp "
FT                   /protein_id="CAK36933.1"
FT                   /db_xref="HOGENOM:HBG329914"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="UniParc:UPI0000EF9E20"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D6"
FT                   /transl_table=1
FT                   /translation="MSGFLYEATTPCPSRTSASIFSRGSDRCSSDSMWEDSLGNWDDTA
FT                   NVEFTTEIKQSVLTGAKPRRRTKTSTSFAIHEDLGGKPTQPTYKPKRDSSIAAPTTSRK
FT                   TSLLAQPAQRFRPKVSFGPSPDTQLRQEGLAHKSTTKRTDTEKNNALLMRINGADGQGK
FT                   VKESLKMDVRRNTVYIPPDDGTVASVFMGLFSPLKSDDFEKCMNEDTQVNSLESQIARK
FT                   RQAKRSLASSAQRAPLRPSSKVMQESCIHHDIAGKNGGKENVPPGTVIAEGKKGNQPLK
FT                   IKGDLGSRLNAPPMAARRAGATNAPAKPTSKPLSTKTNNPLHRSNVLSNSQNSTKSQQN
FT                   KPEHNRTMKPSLTSEYNRLGSMRSPNSSTPRKPSKTSTILKPTTSRSNVKPIAKECPII
FT                   LDSITNPALYEENWLSHQEVAITQLVNELLRCTYEESEIDNHTMLRHELLALYQGESFA
FT                   YLHKRLQASLLYGAMSIPKDVLMRSSRLHNDLGLKRKFLDIWIKTYDPRALRAALEAVT
FT                   GRKIPTPKLVHESDTSDNDKAMKRRLEGFLDAFLLQNQDINHQEKTCVGEDGGAAGRTY
FT                   RRTVLRSIMMVILLDKARMCQGTAVPRRLFLSSSPVKSSVAVLQALGRFLLPSCGDMIK
FT                   ALSHLDCELSYEQHPLEEYDYRVDNLAVDLRDGVRLTRVVEIFPLSSHLKFPCRSRAVK
FT                   LFNIKIALDALASEPGTRKLAKDIRAEDIVDGHREKTIALLWKLVSTWGLAGLVDWTEV
FT                   RKEIERLRQKAALHAGHGDAEDNIWHDMCINRNDESDEPTLLLKQWASTLAHLKGVPLD
FT                   NLSTSFSDGKIYESIIDEYEGYIVDRPESYSRTASLDSRLRALGCSAQFGEFTKDLTPF
FT                   TATNIDQPNSWPPLRRLVSSIAILQSEHSRSFVRGFCPLRNAREPRQYFSRHGDGSLRV
FT                   ETMSAEPSQGTLPDNAPQLYKLSTGSYGRRK"
FT   CDS_pept        join(complement(940824..940829),complement(940747..940767),
FT                   complement(940610..940643),complement(940339..940376),
FT                   complement(940276..940284),complement(940144..940215))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877880"
FT                   /orf_name="An01g03980"
FT                   /product="Title: questionable ORF "
FT                   /protein_id="CAK36934.1"
FT                   /db_xref="UniParc:UPI0000EF9E21"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D7"
FT                   /transl_table=1
FT                   /translation="MYLVVTVFQSKFIFIIIESTKSKGRGGVGHSSWQVLPIDYPHYLS
FT                   PMYIITLDNFISYL"
FT   CDS_pept        join(complement(942203..942318),complement(942062..942110),
FT                   complement(941956..941989),complement(941718..941874),
FT                   complement(941548..941661),complement(941425..941491))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111063"
FT                   /orf_name="An01g03990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36935.1"
FT                   /db_xref="UniParc:UPI0000EF9E22"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D8"
FT                   /transl_table=1
FT                   /translation="MPSTIPNTWANDCDCGIEDGGGISKVETGRSEKEYPPGRGKERAT
FT                   RLRCSLNRLDDVHRRDDTKSEATPASKEHLAIPSEPAIDRSFLRRTPEGASPDGGVAVS
FT                   ANNNPAIKVRSRQHRAFAARLLYAVREGSQSPLAIDLVIGQGGGETKDRKEETAAADDY
FT                   LLTSLRIRSLIQNSI"
FT   CDS_pept        join(942391..942721,942772..942830)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806939"
FT                   /orf_name="An01g04000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36936.1"
FT                   /db_xref="UniParc:UPI0000EF9E23"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D9"
FT                   /transl_table=1
FT                   /translation="MCRGRTVGRPLLLRTPGKTGDRPLPLSWGSSSQTLAHSSATGVVR
FT                   NLAVIILAAILRRTGGKVTGRCQELPWNVQRGGMSIEQGAVETGTTRFFYSASQLKGSL
FT                   IFMVAWVGIVTLPRGCDVCDVEGFG"
FT   CDS_pept        join(complement(943311..943434),complement(943098..943144))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111064"
FT                   /orf_name="An01g04010"
FT                   /product="Similarity to protein SEQ ID NO:5110 from patent
FT                   EP1033405-A2 - Zea mays"
FT                   /protein_id="CAK36937.1"
FT                   /db_xref="UniParc:UPI0000EF9E32"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E0"
FT                   /transl_table=1
FT                   /translation="MIDGWGSWTRSIGESSLTPLAVELNPPPDIRHSIHGFYADKRIGY
FT                   TKDKMVANAAI"
FT   CDS_pept        join(complement(949208..949268),complement(948985..949125),
FT                   complement(948647..948730),complement(948222..948467),
FT                   complement(947999..948129),complement(947566..947733),
FT                   complement(947207..947323),complement(946910..946965),
FT                   complement(946712..946865),complement(946434..946496),
FT                   complement(946010..946069),complement(945809..945907),
FT                   complement(945543..945640),complement(945181..945440),
FT                   complement(944542..944768))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877881"
FT                   /orf_name="An01g04020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36938.1"
FT                   /db_xref="UniParc:UPI0000EF9E33"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E1"
FT                   /transl_table=1
FT                   /translation="MHSRYRSIVALIDPEGGNEGCPRKGEERQVCGQEMDLRLLQRLAA
FT                   QRAPEEEDASKEFRRCNVLAVLAKRRAGKKAQPQRVNDDSQGKRGGRAAPGGRETLSPT
FT                   NPAKPRPTLSFSSPNPCMLRFLRLRDAGQYQYLGILYAPVNTQPSCYLLVGNYRQAKTP
FT                   SWREEAPSHKGLEKRVTGFVTSRFHPWGKPAPKYKKQKTMRHFGGWLPRRANLDLTNPS
FT                   KERLSDKEGGYSMRRNEPPRGQDSAGARAGIIAARAATVVCGKVALPTVGAGNARVPRR
FT                   SYLFRLIRSVAAPGIHTTHHHPTYSIHSTPNQTNMLGLNLVVPDPESDGLGPVTLSQSE
FT                   AVVTSTVGASRVMPMMRARTTNLPACYRHHWELRTNCKRSLDDSIPRLAMGQAGGFHVF
FT                   NLPRSPLKPSSCLPPGNSTVIIPGMVTQAFPTRKAQHVQRVAVMESVRGKKEAGKPIGI
FT                   GLIVSGRMETRKREKKQYGDDDQIHARWQSNWDKRVAISKAETIERANSTPSTTNGLTI
FT                   KKPAHPRSLRMGGAARLLNASRSLQVLGQASCDSGITPTQCHGCSGRCSFPQSQQPICA
FT                   SREFLSEGSSSMTANTDSPHLDREQDTRYMLLMYTYVPNTSGICATRPRSQDRNRLSAN
FT                   KLRPSTERKNRIRNINYIQ"
FT   CDS_pept        949555..951666
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960199"
FT                   /orf_name="An01g04030"
FT                   /protein_id="CAK36939.1"
FT                   /db_xref="HOGENOM:HBG329921"
FT                   /db_xref="InterPro:IPR018853"
FT                   /db_xref="UniParc:UPI0000EF9E34"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E2"
FT                   /transl_table=1
FT                   /translation="MLLSPHQSSKSAPQEADMVEDIDEPPDHRFLNTSMNNMDDGVVYV
FT                   KSTAAMTDRKESLLTRALKSSPPPSPADRHSPSQEHSFYRSYTYTNISGISTAELTSDG
FT                   GLTSPSLSNTPSPPLPSHLSNNTSSMGDKRKAEAVEVGESAVEANLGRKRCISFACGRK
FT                   AEEQKPQNPSPQRPVTKIHDASVTPTEPKRRTVLTFVCPARDPETRRERSPLRGGCRPR
FT                   PRGSPAPMARKASPEKAAPSPVSKASQEQKIDRRGVPTKGLGKFEESEATRFHEFASSV
FT                   EEDDEWVTKSGEYSEKITLNDCMKKENAIRKLGEEAEEEALEEDDEDDVEDSDDDSTVH
FT                   DFSSDDGNESDNEAGFAESDESDDGSEYDFWAPTSTTAATSPQNADIARHPFSRRDSNT
FT                   SFDSANDVQQQQRWSPVLSAKTTSRSPMKIPKLRPGTPNLPDSTDFVCGTFDEDRPLEA
FT                   AYKSCIEQRRLSKQIVIPQDIDPSFPTSDPEDEEDEEDDIEESVMDEGPRGRTGRDSAQ
FT                   KPSPRTSPRRMVSPPPRRQGRSSPKRLRSPPPPMKLRSSKDDLASADEAPAVPSRGLNI
FT                   SELVQRPAMSRTKSLPRTPNPFFTSLDKSHRWSGIVPVYESPERESSRTREVHTRGPID
FT                   IVEGLEKKRQKRKEKFWRQHCRKAAKEQMVRRPIPGKGAERMKELGLEVAERCRAYGVG
FT                   ENAQLVLSV"
FT   CDS_pept        join(952476..952494,952653..952756,952920..952959,
FT                   953062..953127,953203..953502,953567..953607)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877882"
FT                   /gene_name="sar1"
FT                   /gene_synonym="sarA"
FT                   /orf_name="An01g04040"
FT                   /product="Small COPII coat GTPase SAR1 "
FT                   /EC_number="3.6.5.-"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAK36940.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI0000EF9E35"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C951"
FT                   /transl_table=1
FT                   /translation="MWLINWFYDLLASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDRV
FT                   AILQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHERFP
FT                   ESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDELRHQLGLYQTTGKGKVPLEGIR
FT                   PIEVFMCSVVMRQGYGEGIRWLSQYV"
FT   CDS_pept        join(complement(955820..>956119),c
FT                   omplement(955646..955741))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877883"
FT                   /orf_name="An01g04050"
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="CAK36941.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI0000EF9E36"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E4"
FT                   /transl_table=1
FT                   /translation="IPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKH
FT                   DMDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKP
FT                   AEKKQKYVYGGMSSGRPITPPRKQKKK"
FT   gap             956216..956315
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(960021..960289),complement(958923..959937),
FT                   complement(958034..958874),complement(957769..957984),
FT                   complement(956837..957717))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960200"
FT                   /orf_name="An01g04060"
FT                   /product="Function: TFC4 of S. cerevisiae is a subunit of
FT                   transcription factor tau"
FT                   /function="binding"
FT                   /protein_id="CAK36942.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG329922"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000EF9E37"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E5"
FT                   /transl_table=1
FT                   /translation="MDYPDDHHPHHQPPSQEYVYPDIDETIHYPWQGNQPTTQGEASIH
FT                   SVLDPRLYKDLFTGNASQAQDEASLDEDAEAYHDADDSDESLYTFEEEFSNQADEDDEA
FT                   YGRRRRRGTGPFSGRYGARGGKGIRRGPRKPLEPSPEFKILHSEATSAFIDGDYDRAID
FT                   LTKRAIQVNPEMFAAHSLLSEIFLAQGEKDKALTALFSGAHTRPKDPTVWAKVARMILE
FT                   RAGEERQGALNDVIYCYSRIIELDPKNYNARFQRAAIYRELGYNGRAATEYERILKEVP
FT                   HNARALRHLAETYIDLNDVQKAVDQWRVSVKYFTSLEPEDAPEFSWSDVNIYAELYSYL
FT                   GRPFEGLKALKSVSRWLLGRKDDTMWEDFHEDDREWDADDSPRRIKADGYEPRRWPRDS
FT                   YGLGLPLELRIKLALFRLRMGYEHKNEALKLQHHLEWLNPEDTSEHARLYDYGDLFREA
FT                   ADALKDVGLFEEALRFYMPLQQTNEYADVGFFMAMGECCSVLGKLEDAENCFLTVAEHD
FT                   ARHVESRVQLAKLYEGIGMSEEALKYVNEAVLLGRQESRSNRRRKDTRLEQLAVEFKAA
FT                   DAAREDAALRSIAPQPPSADLPAALTTTTTSAAKDTEINEEQRIANVQYLYDKLMQLLP
FT                   QAKEGNAEATEDWLDIADALLREFRSNRVFYPIQRNITFLGYSREAQRKAGRHKGRNFI
FT                   DEMQEMAGRLQESLGSIPDEPLQGAIPTDYYGISFNEWLDLFLQYALTVATQGESDEAY
FT                   DTLAAAADASVWYHSKADTRMIHVCWFTCALRMQDEETLANEARWFIKEYQFVTDTYRL
FT                   FAMLSRLVGDPHRSLFHSSPNMKFMLRQIKAMDFTVPDEVTGERPNRFVRESAYKERAS
FT                   LSTRDETTGEAIPADEMDVALLVLYGHILYSGNSFYPALNYLFRAYALDDQNPAVLLSI
FT                   ALCYIHHSLKRQSENRHYLIMQGLSFMQEYRRVRERPGSLLSERQEMEFNFARVWHSLG
FT                   IAHLAIEGYQLVLDLGAQIQAQSQQTIPHPKDGSDVVMGDTGLEAQAPFVEDFSREAAV
FT                   ALQIIYALNGDYQSAQKVTAKWLVI"
FT   CDS_pept        join(complement(961033..961112),complement(960827..960935))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654277"
FT                   /orf_name="An01g04070"
FT                   /product="Remark: the predicted ORF is only 62 amino acids
FT                   long"
FT                   /protein_id="CAK36943.1"
FT                   /db_xref="UniParc:UPI0000EF9E38"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E6"
FT                   /transl_table=1
FT                   /translation="MERSNRTSQERKKQEAKRKNDTLPWRASDTLEHHSSTFYIFCNID
FT                   YIDNPIDQDLTISSPFI"
FT   CDS_pept        join(961990..962491,962550..963832,963887..963943)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877884"
FT                   /orf_name="An01g04080"
FT                   /protein_id="CAK36944.1"
FT                   /db_xref="HOGENOM:HBG323888"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI0000EF9E39"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E7"
FT                   /transl_table=1
FT                   /translation="MASHIIGNRNSTPEASKSSLRPPSSSRNLGSHQLRASADMSGFPS
FT                   PLSSRSIRPSSEVYFNQQSQASNNAEDPLDRAAQQWLADIDQYETTLEEMAAATLDQDF
FT                   KDELSAIEQWFRVLSEAERTAALYALLQQTTQVQIRFFIQVLQQMAKSHPMSGLLSPAN
FT                   FGEKDAMSNRLNDAMSKLNVDSSRSSLGRPPPSPGAKRNSGLDSSTINAMFPDAAAAIA
FT                   KKKAEFTQQTGNAPPSNRNSAVFDRTSFVAPTISAPDNSNDTLGQPPVSPWAQRGSEPQ
FT                   PPIARPKSSSGHQPMGQFSQTPSSLRSPLPTQTATIPAPEIDAPLLSPYNVGNASWASM
FT                   TNTPMTATFGQQPQQPQQNSQADMVANATAMKLAALSTVNNRIALDDARKYRRARSNDG
FT                   QGKNSANSHAMSQGGLASPGLPGHSHLVAGQLLNTQQLAALQAQQQAAMAGRRSRPTSP
FT                   GIAMQGAGGLGPMGFTSPQNNGFLAAYDPNNPLMGNGLGALGIGQFGLGGPEGYLSDHS
FT                   EVARGRSPRGRRGSSKPPEDPTDPNLLKDIPSWLRSLRLHKYTENLKDLKWTELVELND
FT                   KALEDRGVNALGARNKMLKVFEQVREAKAEGKLDNIA"
FT   CDS_pept        join(964270..964278,964378..965058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877885"
FT                   /orf_name="An01g04090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36945.1"
FT                   /db_xref="UniParc:UPI0000EF9E3A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E8"
FT                   /transl_table=1
FT                   /translation="MALKVVTHQRRNQPAIYSNSDIMLPTYLAIYQLITTTNTIIHPPT
FT                   VHHPKPHNQKQSKCHPQNKNSLSSSTPSSRNLSNTTTGCVKPSPKPTNLLRTLSLTIPP
FT                   ILIPQTLSSLHSLTSFLLGLTAGILSLQSATGFLFYLLGTVFVSALFHALLLYRSGGLG
FT                   AGMYFAGANGEVEGMDERGVVSGKGTKGGGMLRRAAWRDVWFGGGVLSEALSGFILGWA
FT                   GVGGVLR"
FT   CDS_pept        join(complement(967214..967544),complement(966815..967154),
FT                   complement(966750..966762),complement(966666..966701),
FT                   complement(966223..966619),complement(966063..966119),
FT                   complement(965376..965995),complement(965215..965316))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877886"
FT                   /orf_name="An01g04100"
FT                   /product="Function: mdr of B. subtilis is a multidrug-
FT                   efflux transporter for e. g. puromycin "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK36946.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329925"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9E3B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E9"
FT                   /transl_table=1
FT                   /translation="MIKAYKYISQKTKDSKSPAPKPLCAHRSQWYQLESTNREDSESLE
FT                   RPMSGSTKGLSPATGTDKCRLCKEQKHNARVYRVKLIAGLTLPFTLSTLDLTIVATATS
FT                   TIASHFNQFDELNWIITAFSLTSTTFIPIFGQLADVFGRHIVLQTALFFMLIGSVLCAA
FT                   AQTWGMLLLGRALQGVGSAGLNNIIMIILADKVSLKENARNKSIFTIFGGVGYAVGPVI
FT                   GGYLTDSNWRYCFVVPIPIAVLSHIMIFVLLRNDLVEGTMFKKGSRWSSILPALATIDL
FT                   GGSILFIFGVGLIILGTTWGGATYSWSSPQVLAPLIIGAICFIAFFVYEYLLEPGRLFA
FT                   RIFPKHVAMLPYGLFERTDTIWLAIVNFSTGVGYSTSKAGLELLYYIPGLGAIYFCNGF
FT                   PRQTFFPLLMGAVLSTVGLSVVAYAISAQETSLLSGMLVITGAGVGLRLMPSSLHTVGI
FT                   WPERIAPAMSLMQVSLPFGGTLGLTIMTSVFNNKFGRSSALRGLEGTGSSLNVHDTDSL
FT                   AFLDNLPAAVQDSIRMAAKNAIMWAFISIIPIVGLSLLTTTFMGNVWVNVRGKNDGEHV
FT                   GEDDGEGRSEVIHVPYLWALAKGTINTHKRISKPISSNTQPPSPLRQPTLQHSTA"
FT   CDS_pept        complement(968260..>969306)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877887"
FT                   /orf_name="An01g04110"
FT                   /protein_id="CAK36947.1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="UniParc:UPI0000EF9E3C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F0"
FT                   /transl_table=1
FT                   /translation="DGIYCTICVSVAVLLFRVAKARGQFLGRVTIHSVVGDHLVQGDGK
FT                   YGPGGFPDAPNDDEGGSRRSIFLPLNHTDGSNPEVEVEQPYPGIFIYRFSEGFNYPNAN
FT                   HYTDYLVQAIFRQTRRTNPFSYARPGDRPWNDPGSRKGKEENRSQRPILRSIILDFSSV
FT                   NNVDVTSIQNLIDVRNQLDLYASPRTVQWHFAHINNRWTKRALAAAGFGYPTPTSDDGF
FT                   HRWKPIFSVAEIEGRASAAAHAEMINNEHAHQNAIKRDIEEGLKHETHMTEREASGIDI
FT                   EASSDNSSTPDDKLARDLKDSKAYRNRRKAAVVQGINRPFFHIDLTSALESALANSPPE
FT                   EPIEEPSA"
FT   mat_peptide     complement(968263..969237)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F0 "
FT   gap             969423..969522
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(970065..970241),c
FT                   omplement(<969574..969975))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877888"
FT                   /orf_name="An01g04120"
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="CAK36948.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI0000EF9E3D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F1"
FT                   /transl_table=1
FT                   /translation="MADQDVDLDSIIDRLLEVRGSRPGKQVQLLESEIRYLCTKAREIF
FT                   ISQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFVLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI
FT                   IDEKIFTMHGGLSPDLNSMEQIRRVMRPTD"
FT   CDS_pept        join(970825..971096,971182..971228,971328..971443)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654278"
FT                   /orf_name="An01g04130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36949.1"
FT                   /db_xref="UniParc:UPI0000EF9E3E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F2"
FT                   /transl_table=1
FT                   /translation="MKAKRVDNGEMRLAGFERRKISLGERLLLDGAVAKNSSRRRERNG
FT                   VGWGEKQGPTSEAEIGGELFFSFEDGWKKSAGEVGTNPISSAPDVAEKCKRVRVSVTRE
FT                   SESFWENRPRLKKDFRAKFHEKQENHEQTECEESKQDRDR"
FT   CDS_pept        complement(972516..972671)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806940"
FT                   /orf_name="An01g04140"
FT                   /product="Remark: the EST of A. niger can be found in
FT                   EMBLEST:BE759969."
FT                   /protein_id="CAK36950.1"
FT                   /db_xref="UniParc:UPI0000EF9E3F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F3"
FT                   /transl_table=1
FT                   /translation="MTFRARDDPSGCILKLFLLFTFSFLPFGVLPFSTDYFLGPPWPMM
FT                   RFGSNA"
FT   mat_peptide     complement(972519..972578)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F3 "
FT   sig_peptide     complement(972579..972671)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F3 "
FT   CDS_pept        join(complement(975837..975878),complement(974920..975739),
FT                   complement(973359..974806))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211044" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806941"
FT                   /orf_name="An01g04150"
FT                   /protein_id="CAK36951.1"
FT                   /db_xref="HOGENOM:HBG329929"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI0000EF9E40"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F4"
FT                   /transl_table=1
FT                   /translation="MEKLNTEDGQLFIKNLASFVRTHEKALANALQLKRQPTKNAQSSH
FT                   TQSGSSSSASSTLAAALSFGALKFTSQNVKPAKLTLTPHHLFYLLSRFEELSIAVGPLN
FT                   VRLENIHTDGSQSYVSFLNKPQRSRGDRDSIHSVSSVRSVMSGMSSLWSSFGLVSKDSA
FT                   SKSEKAKAALEADTKYLYSAFTKIPCLRLAPDRRARLIRGYEEFPFDTAVPLHSFKNLS
FT                   ALEIIDIDFRSFFGWDRLSEQLRTLTVKRANIEDPAELLTGIVLDDIDKRRRRSSKHHH
FT                   SPMMGWTSMIRMASEGSKARPRTGSTSPTRPTSSKHSTYRHGRGTASRIRRTGSGSSNS
FT                   SETSGHRSASSSNLLSGVLPAHKWRFLRHLGLPDNSLTSITAAGLAPVANTLQSLDLSS
FT                   NLFTEVPDSLASLVALRALNLSHCMIESLHSLSRNPLPAITALNLRGNRLRSLAGIERL
FT                   LSLERLDLRDNNLTDPTEIARLTNLPEIREIWVSGNPFVKTHPNYRVVIFNLFRRTPGY
FT                   SEDIIIDGSGPGYTERKQLVERAAEPEAAPVIRSAAADLSTVVSKPLHTVPQEPSLPYE
FT                   QIGPVGRVGQNGVDVGSTRRKKGTRRKISDRPKDKPSADVNRDSGAVVPSIPSVQPVQL
FT                   PVDPFVTATPDRQWKSDGGPQARPASPKIPERTEIGRDSSALQTQDQQLGLQRALQGKD
FT                   WSVDGDFYKRQLEALRQELGNSWLRTLEEHRWKDVQTDINVSCTAADYADPTRIPVDPL
FT                   TRVNPQVILSGGHALN"
FT   CDS_pept        join(complement(978726..978795),complement(978667..978670),
FT                   complement(978348..978360),complement(977976..978100),
FT                   complement(977687..977776),complement(977483..977629),
FT                   complement(977295..977439))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806942"
FT                   /orf_name="An01g04160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36952.1"
FT                   /db_xref="UniParc:UPI0000EF9E41"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F5"
FT                   /transl_table=1
FT                   /translation="MGGGQLIIKMRLRPPLEPLKNVKVKYELLGAISCTFGDPPPITGR
FT                   LDIVRPVTAGTVASAQEAGPPSSTARYLAQSDQHGVCVLRPPDWPRNPSALQTKSICIL
FT                   LVLRYCISQVQGSAIGIPASRDSERLLHSSPEPKNGTPWLTVAVILNFWISIGTERGNA
FT                   IRTTPTMRNAKILRDRLSIHHGLVQLSNPEYPAR"
FT   CDS_pept        join(979942..980039,980067..980113,980277..980446,
FT                   980519..980637,980774..980878,981078..981161,
FT                   981269..981334,981613..981894,982008..982085,9
FT                   82393..982492)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877889"
FT                   /orf_name="An01g04170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36953.1"
FT                   /db_xref="UniParc:UPI0000EF9E42"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F6"
FT                   /transl_table=1
FT                   /translation="MVSHILGLNPVGDNVGYRAKHPSRLRCRNARLGQIVCPGAVDGWN
FT                   GDPVATKTQESPGREWKTECGYGVTPVGSDDSKGGSPLQSTARMISSRSRLSSPIKADI
FT                   AGENAKAVGGRETDREMNSDQGCLSVPSLRTLRTYVPHYILIDPDASHHFGKPKHSTRL
FT                   MIDRRQTAEAWFMNRGRCGSKPDAVCWTEGTRTIERKKQVTYGGGSATCKKNLPVLAKP
FT                   YESTTLAGKSDKGCSANSTPIEPMLIAMPRAACHTDIFIQTGGNIEIQAANVRRTVLLE
FT                   GRGDGTLSGWWAGRNLSWSYGRAAERLSFATLLTTYATLIGDLVCVRDTHSNAPQISAA
FT                   GRAHGRHLITRILGLTGSSITVLLIAVTDVCAKKAEPYIPGQ"
FT   CDS_pept        join(982925..984364,984431..985240)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877890"
FT                   /orf_name="An01g04180"
FT                   /product="Patatin-like phospholipase domain-containing
FT                   protein An01g04180"
FT                   /EC_number="3.1.1.-"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid catabolic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK36954.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG396101"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI0000EF9E53"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8F7"
FT                   /transl_table=1
FT                   /translation="MNGAEKSAAGDTYDPSTIPDYDREFIHPDDLRQFELALTDQGASP
FT                   LVALNDWRPIYQRVRRERGRRKEPRRTKDETREGVLYTVLKWPFLFTVFGWITALAFAY
FT                   TLTRVYIFLYEQWVTWRGRRQSLRRQLHAQTNYPDWQKAARALDDHLGNQRWKEIDEYA
FT                   YYDHLTISNLVKQLKKVRREVERERREKRRGSGQSPAAEELCTLLEACVKNNFAGVENP
FT                   RLYSEAYSGTKNLVQEYIDELHACIQLVADSKGITSEEKLQHFKHLDTNFGRTALCLSG
FT                   GATFAYYHFGVVRALLDNGVLPEIITGTSGGALVAALVATRTDEELKQLLVPALAHRIR
FT                   ACQESFPTWVWRWWRTGARFDTLDWARQCSWFCRGSTTFREAYERTGRILNVSCVPSDP
FT                   HSPTILANYLTSPNCVIWSAVLASAAVPGILNPVVLMTKKRDGTLAPYSFGHKWKDGSL
FT                   RTDIPIKALNLHFNVNFTIVSQVNPHINLFFFSSRGTVGRPVTHRKGRGWRGGFLGSAI
FT                   EQYIKLDMNKWLRVLRHLELLPRPMGQDWSEIWLQKFSGTVTIWPKTIPSDFYHILSDP
FT                   NPERLARMLRVGQQSAFPKLQFIKNRLKIEIAVVKSLQKFAHAGGRPISPAPSRWRQNN
FT                   DPDNHYNPSPRTDPLNERLDHNLPERRGDNVNITFGEGGGREDTHLLDGSLSENSSNES
FT                   AARPSSSSSSSRLLRVPEHRRGSTGSSIFEEVRRQSAVFFDDVDMYGDDEALRPG"
FT   CDS_pept        complement(986246..986410)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806943"
FT                   /orf_name="An01g04190"
FT                   /product="Remark: the predicted ORF is only 54 amino acids
FT                   long"
FT                   /protein_id="CAK36955.1"
FT                   /db_xref="UniParc:UPI0000EF9E54"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F8"
FT                   /transl_table=1
FT                   /translation="MKSRRYSLFLPRDLANGLMRAYWDKSHFLYSVIDRGNITVMYLKC
FT                   PSDRSYRRY"
FT   CDS_pept        join(987020..987040,987079..987150)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877891"
FT                   /orf_name="An01g04200"
FT                   /product="Remark: the predicted ORF is only 30 amino acids
FT                   long"
FT                   /protein_id="CAK36956.1"
FT                   /db_xref="UniParc:UPI0000EF9E55"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F9"
FT                   /transl_table=1
FT                   /translation="MTIIHSKMEFSVVSLTSSSSSIITPWKPSI"
FT   gap             987537..987636
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(988964..989264),complement(988748..988893),
FT                   complement(988141..988684),complement(<987637..988073))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210988" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111065"
FT                   /orf_name="An01g04210"
FT                   /function="secondary active sulfate transmembrane
FT                   transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAK36957.1"
FT                   /db_xref="GO:0008271"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG356203"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="UniParc:UPI0000EF9E56"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G0"
FT                   /transl_table=1
FT                   /translation="MSQDLMTKTGHGLAKVLGIKLPYRDPLGAHSDPVTRGESTFSYGT
FT                   VDTYSYLEPEPTTAEWLKEICPTWHDVLMYFYRLFPFLSWITKYNLQWFFGDLVAGVTV
FT                   GAVVVPQGMAYAKLAELPVQYGLYSSFMGVLVYWFFATSKDITIGPVAVMSTLVGTIVL
FT                   QAQKEIPDVPGHIVASCLAIICGAIVCALGLLRLGFIVDFIPLPAISAFMTGSALNIAA
FT                   GQVKKLLGESADFSTRGSTYMIIINSLKYLPTAGIDAALGVTALAMLYIIRSGCNYGAR
FT                   KYPRHAKVWFFASTLRTVFVILFYTMISAAVNLHRKDNPMFDLLGSVPRGFQNAAVPVV
FT                   NARIIKVFASQLPACVIVLLIEHIAISKSFGRVNNYTIEPSQELVGIGVTNLLGPFLGA
FT                   YPATGSFSRTAIKSKAGVRTPLAGCITAIVVLLAIYALTAVFFYIPQAALSGVIIHAVG
FT                   DLITPPNTVYQLLARTRP"
FT   CDS_pept        join(991205..991284,991325..991591,991808..991944,
FT                   992030..992262)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877892"
FT                   /orf_name="An01g04220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36958.1"
FT                   /db_xref="UniParc:UPI0000EF9E57"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G1"
FT                   /transl_table=1
FT                   /translation="MSGSHKPTPTPAKQAAVVQANGTVLTTWNLNGRTRPRLPFTFSNE
FT                   TLPTWLGSIVVLELLGTKLPFPSDKHGSPTRQLTCCLLIYNPIVCLARLTQPQMERDIL
FT                   SLTGHVDGGFRPCELRRFPRIAPSILSLRDAAVEGNHWKINLMWFDACRRSIDIERFAG
FT                   SSSAIVALSLGCAEIPLQLVYYTPAAAASPCYGQFHRTMSPTIHIPTFVCRYLHFLADL
FT                   SAQGQIRQNAAANPTS"
FT   CDS_pept        join(complement(994769..995154),complement(994039..994707),
FT                   complement(993587..993977))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111066"
FT                   /orf_name="An01g04230"
FT                   /protein_id="CAK36959.1"
FT                   /db_xref="HOGENOM:HBG329936"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0000EF9E58"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G2"
FT                   /transl_table=1
FT                   /translation="MSAHFQHPLQCLRLVQRSTANLLIGSAGSKLYSYSAETGQRLAVW
FT                   PEDVASSETKPVDAESAPEQGPPEKKRKVSSSDSPTIEKPAWSNIPIVTGTASGEHIIA
FT                   LTAEDKCVRVFQLQEDGSFVQLSQRVMPKRPSAITLTDDDDTILCGDKFGDVYSLPLIP
FT                   SDKLPAITKSLRSAKLSHPAATNLTVHTKGNRRALEQQLRLASEGKRDEKSSGPTFEHK
FT                   ILLGHVSLLTDMAYVSLPVDENKKRSYILTADRDEHIRVSRGPPQAHVIENYCLGHTAF
FT                   ISKLCVPQWAPQYLVSGGGDNYLLVWKWAEGRILQKVSLVDEASESTEVAVQGIWATSL
FT                   GNLRIILVALHGSSRLQCFTLESDGSLKTQASIQLSGNVLDLTPVEKDNTILVSVDSIR
FT                   QPDSTQEWRTSPSSPSTLIEAFHIKSGTDSLEWEPTAASVTDKINSTGTEEVPATTEEK
FT                   QRKELNDSLYGLGHLRKRKGEDE"
FT   CDS_pept        join(995490..995663,995721..995790,995855..996549)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654279"
FT                   /orf_name="An01g04240"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="ribosome biogenesis"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK36960.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG601294"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI0000EF9E59"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G3"
FT                   /transl_table=1
FT                   /translation="MGGKSATKAAYFEKLKALLDEYKTVFIVGVDNVSSQQMHEIRLSL
FT                   RGEGVVLMGKNTMVRRAIKGFVNDNPEYERLLPFVKGNVGFIFTNGDLKATKEKILANR
FT                   VAAPARAGAIAPGDVWVPAGNTGMEPGKTSFFQALGVPTKIARGTIEITTDLKLVEAGS
FT                   KVGPSEATLLNMLNISPFTYGMTIQQVYDQGQCFSSAVLDIEESQLLEAFSSAINTITT
FT                   ISLAVSYPTIPAVMHSLVNSYKKVLAVAVETEYSWPEIEELKDRIANPDAYASAAPAAA
FT                   AAPAAGGAPAAEAPKEEEEESDEDMGFGLFD"
FT   CDS_pept        join(997368..997422,997478..997519,997618..998541,
FT                   998591..998661)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000253896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877893"
FT                   /orf_name="An01g04250"
FT                   /product="Catalytic activity: Uroporphyrinogen-III [ "
FT                   /EC_number="4.1.1.37"
FT                   /function="uroporphyrinogen decarboxylase activity "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK36961.1"
FT                   /db_xref="GO:0004853"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="HOGENOM:HBG628392"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="UniParc:UPI0000EF9E5A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G4"
FT                   /transl_table=1
FT                   /translation="MQHQFEPLKNDLLLRAARGEKVQRPPIWVMRQAGRYLPEYHEAKA
FT                   GRDFFECCRDPEVASTLTIQPIDRYAGLIDAAIIFSDILVIPQAMGMQVEMVDKKGPHF
FT                   PEPLQSPDDGQYEKVMQKDVDVKSELDYVYKAITLTRHKLQGRVPLIGFCGAPWTLLCY
FT                   MVEGGGTKLFVQSKKWIYKYPKESQALLQKIAEICVEYLALQVAAGAQLVQVFDSWAGE
FT                   LSPAAFKSFSLPYLRHISANLPKKLKEMGLEPVPMTVFAKGAWFGLEDLCESGYNVVGL
FT                   DWLHDPAEARRIANGRVTIQGNADPGVLYGGREAITEAVETMVRGFEKGKQGWIANLGH
FT                   GVTPFVNPDDLKFFFEEIHRLTV"
FT   CDS_pept        join(complement(999195..999353),complement(998860..999125),
FT                   complement(998761..998782))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960201"
FT                   /orf_name="An01g04260"
FT                   /product="Catalytic activity: cytosine + H(2)O [ "
FT                   /EC_number="3.5.4.1"
FT                   /function="cytosine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK36962.1"
FT                   /db_xref="GO:0004131"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG741046"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0000EF9E5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G5"
FT                   /transl_table=1
FT                   /translation="METDPGFIAAVEEAKQGAAEGGVPIGACLVSKDGKILGRGHNMRV
FT                   QKGSPVLHAEMSALENSGRLPASAYEGATMYTTLSPCDMCTGACILYKVKRVVVGENKS
FT                   FMGGEDYLKSRGKEVVVLDNAECKQLMEKFMKEKPELWNEDISV"
FT   CDS_pept        join(complement(1001340..1001377),
FT                   complement(1001208..1001293),complement(1000923..1001103),
FT                   complement(1000683..1000824),complement(999940..1000137),
FT                   complement(999446..999511))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654280"
FT                   /orf_name="An01g04270"
FT                   /product="Similarity to EST SEQ ID NO:4107 from patent
FT                   WO200056762-A2 - Aspergillus niger "
FT                   /protein_id="CAK36963.1"
FT                   /db_xref="UniParc:UPI0000EF9E5C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G6"
FT                   /transl_table=1
FT                   /translation="MEQAKQRGLETKEGEESRRREGGQVRGGRKKEELERERVRPGPGT
FT                   NRPLICRTSAVKTRQEFQDGRIKYRRYDGAKLREYRNAGEDERPRFNWLELELYRKRLN
FT                   GVVLFASTSPVTRSLDGPSVASDCFDAIPCPSTAFAPFPSLTIALGKKKACRDSPPGDS
FT                   SRSPIAGWLRFNWLMPGVLYCSSAAAEAINGSIPEYQTEIGFCGSCHDRGSELRTSSPM
FT                   RVSPAVNHTEFAPS"
FT   CDS_pept        join(1001523..1001558,1001628..1001697,1001775..1002593,
FT                   1002654..1002970)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111067"
FT                   /orf_name="An01g04280"
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK36964.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI0000EF9E5D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G7"
FT                   /transl_table=1
FT                   /translation="MVKETKFYDILGVPPTASEAQLKTAYKKGALKYHPDKNTNNPEAA
FT                   EKFKELSAAYETLSDPQKRSLYDQLGEEGLEHGGAGGGMGAEDLFAQFFGGGGGFGGMF
FT                   GGGMRDQGPKKARTIHHVHKVNLEDIYRGKVSKLALQKSVICPGCDGRGGKEGAVKSCT
FT                   GCNGSGMKTMMRQMGPMIQRFQTVCPDCNGEGEIIREKDRCKRCNGKKTTVERKVLHVH
FT                   VDRGVKNGHKIEFRGEGDQMPGVLPGDVVFEIEQKPHPRFQRKDDDLFYQAEIDLLTAL
FT                   GGGTINIEHLDDRWLTVTVAPGEVITPGAIKVIKGQGMPSYRHHDFGNLYIQFDVKFPE
FT                   KDQLKNLELLEQVLPPRMEQSQPPQDAMIEDFELEDIDGSESSQARAHGAASAMDEDDE
FT                   DVPPGAERVQCASQ"
FT   tRNA            complement(1003735..1003849)
FT                   /gene_name="tRNA-Met (CAT)"
FT   CDS_pept        join(complement(1006993..1007071),
FT                   complement(1005138..1006930),complement(1004347..1005078))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806944"
FT                   /orf_name="An01g04300"
FT                   /protein_id="CAK36965.1"
FT                   /db_xref="HOGENOM:HBG329938"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="UniParc:UPI0000EF9E5E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G8"
FT                   /transl_table=1
FT                   /translation="MSATTTTTTPGQMPSNGEVPLDPLDAADYDPIDHLNAIFSHPSTL
FT                   SSVSQVSQSLREYEDELDNDIGALVEDQVTSNAESVERIQAAKADLTELFKKIDDVRDR
FT                   ASRTELAITEMTADIKQLDNAKKNLTLSMTVLKRLQMLTTAYDQLRSLGRTRQYRDCAQ
FT                   LLQAVIQLMAHFKSYRSIDQIALLSRNVADIQRELLEQVCEDFELAFAKGEVGQKRHVL
FT                   SEGCLVMDALGDHAKSRLVTWYCNFQLREYRQVFRNNEEAGSLDNISRRYAWFRRILKN
FT                   YDEEYAPIFPASWRVNEILANIFCEGTREDFKGILSRSVRNGQTIDVNLLLSCLQETLD
FT                   FEHSLERRFVSPSRPSTDTFASSEAPVFGQAISEAFEPYLSVWVEAQDKQLAALIPKYR
FT                   QQPAKPPDEEFDSHIVISSSTDLFTFYRHSLQQCAKLSTGASLAELAKVFAKYLDQYAQ
FT                   VLLYYISERPTGHTPSKVPGTEDLILVLNTADYCYTTCNQLEEKIKGRLDKNLKQSVDL
FT                   QSQADSFMGIASAAVRGLVRKVEIDLEPCWREMRNTPWNRLEGVSDQSSYVGELMSKTQ
FT                   TRCSELLQLLHKQQYARAFADHVVELISNVFIATIFQCKPVAETGAEQMLLDAYTLKTG
FT                   LSSLLPSPAPAGFVKRVNASFAKIEALLKTLQVQPSPPEALVQAYLVHIADQNNANFRK
FT                   ILDLKGIRSRQDQNHLIELFQIHRASDRYAANLQQSNPILTAMQASATPSSGTVSQGLG
FT                   LGTAAASIGASTRFDPTMLGSAIISAAKDGVDRFGTPMSSANTTNLTPGGSAISGALTS
FT                   PASTPGPLGQAQPQGGESTTAAGNLNENLKNIGKFFRRDLGGFGGRFGRSGDDGN"
FT   CDS_pept        join(complement(1007944..1009449),
FT                   complement(1007842..1007889))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960202"
FT                   /orf_name="An01g04310"
FT                   /biological_process="mRNA transport"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36966.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG329939"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR005637"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI0000EF9E5F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G9"
FT                   /transl_table=1
FT                   /translation="MLQLNGFSFAGAPLTTEKYDPSTGGLLDQPMLSAMAQNGGTSSAA
FT                   ETKAKMTTILGKRYTQQTKLLDLSKLGTDPDLLAMGIFGSTSTESKFFPALMKVWELNF
FT                   DNATARREAVESVSLAHNQLANITAVTALASTIPDLKNLDLSNNEFKDAQSLIGWRWKF
FT                   RNLEFLDLSNTPFSADPTFKDTMLKWYPKLRFLNNVEVRTAEEIAAQKKTPIPVQPPHF
FT                   QDDSQIAENFVRAFFAGYDNDRSGILNSVYDNHTTFTLNVNTSAPRAQQTETAPWDAYI
FT                   KKSRNLLKISHLPARMSRVYTGAEKIRELWTSLPATRHPDIATRPEEWLIECYPIPGLP
FT                   DISGQSSTGVGGLLIMVHGKFDEINGAKVETRSFDRTFIIGPGGGMGGIRVVSDILCLR
FT                   AYGGHEAWIPEVPPAVPQAAPPAAPAPAPAAPAAPAALPVAIPGAPEGYGMPAPGKADA
FT                   QVQQEQLVLQMSSNTRMTLQYSEMALSGNGWNMEAALKNFEELKAQGTLPPEAFLPAAV
FT                   "
FT   CDS_pept        join(1010990..1011182,1011250..1011430,1011513..1012064,
FT                   1012143..1012437)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111068"
FT                   /orf_name="An01g04320"
FT                   /protein_id="CAK36967.1"
FT                   /db_xref="HOGENOM:HBG619751"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="UniParc:UPI0000EF9E60"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H0"
FT                   /transl_table=1
FT                   /translation="MPAKSRFTRLDAFAKTVEDARVRTTSGGVITIASLLVILWLVWGE
FT                   WADYRRVVVMPELVVDKSRGEKMEIHLNVTFPRLPCELLTLDVMDVSGEQQTGVVHGIN
FT                   KVRLTSAAEGGRVIDVKALELAKHLDPDYCGECYGATAPAGASKPGCCNTCDEVREAYA
FT                   QQQWAFGKGENVEQCELEGYAERIDAQRREGCRLEGVLRVNKVVGNFHIAPGRSFTSGN
FT                   MHVHDLANFFDADLPDAEKHTMTHEIHQLRFGPQLPDELSDRWQWTDHHHTNPLDGTKQ
FT                   ETNEPGYNYMYFVKVVSTSYLPLGWDPLIETHQYSVTSHKRSLMGGDASDEGHKERLHA
FT                   ANGIPGVFVNYDISPMKVINREARPKTFTGFLTGVCAIIGGTLTVAAALDRGLYEGVSR
FT                   MKKLHSN"
FT   CDS_pept        join(complement(1017196..1017211),
FT                   complement(1016768..1017118),complement(1016551..1016708),
FT                   complement(1013493..1016486))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210933" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654281"
FT                   /orf_name="An01g04330"
FT                   /product="Similarity to hypothetical protein YLR187w -
FT                   Saccharomyces cerevisiae"
FT                   /protein_id="CAK36968.1"
FT                   /db_xref="HOGENOM:HBG329940"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI0000EF9E61"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H1"
FT                   /transl_table=1
FT                   /translation="MGRSRVLSLMSVFGGSSRKDNLSQHHRTSSASLTLNNPPRRVDTP
FT                   SSDTPSPLDASPITGTPHVERRVTSRPESTLFSHNPPLLEFSQDTPPELQPIFGYLNSH
FT                   ANKLYHEGYFLKLNDLDIHGRPCADRQWVECYAQLVGTALSLWDAAALDAAEESEDVCP
FT                   TFINLADASIKMLETLPTRNQGAQSLKNILSICSAGQNRYLLHFNSFHSLTQWTAAIRL
FT                   ALFEHTSLYEAYTGSIIAGKGKGLNSIRTILDRHRYKHEDWARVRFGAGTPWRRCWFVI
FT                   TPPNEKEFQKAQKSIKKKSAYDRAPRLITGDIKFYDTKKTKKAKPIATITDAYAAYAIY
FT                   PQSRALIEQSTLVKIEGKITVHGQTESTTDGFVFVMPEVHPAVSGFEMMLRFLVPTFDT
FT                   FNLYGRPTRLIAATNHIKSIMFAFPNQRRYGYLDILDISSLMQTPGSQDWNEAEWRQQL
FT                   KEATARRMAAAGSRTSSISASKPRFRATMPNRQPNGRTMTHQRNCTSPVNQLDSNQSND
FT                   AVAPGAPRDASISPIHHSRASSDTAGFASIRRQAQAAEVSPASSAQELVARGSERPGTS
FT                   GVDDHRSTGSDRNQRLDPDDEPLGHHFRSTSPPSPVIQPPAFTHAPGEMPAMRPQPSPD
FT                   LRKANNRMSDATLTQLLAASGSMNLLGASFPSGSHETIRESNQPSPLTPNTGSDQQGAP
FT                   SLLSDTSEKRVTLQEQGPPTPEDRSSDFGPPLTLPKRSSLRLDTTKAVKRKPLPAQQIR
FT                   ESDAASVAGEPSYDDLRHTVDEEVLNWVGSRQFSLTSPDIESHQDEESIYDDASANSPD
FT                   YASTRGSVYSKRSVRSVTRPRMGVMKTVGSGPPRQDLVIGDAHYTVDEPKLELSAEIPS
FT                   IDFGPTLTYLPTTGRPNTGDTLKKSMHQRSDSNATEKQFSYQAERQHSRSPSSNVMWQP
FT                   GMTAPRPTTPGRLTAEQFVQQRSAPSPPIATHNRTLSSTPPPPRPVSGDWTNNSRPQSH
FT                   LSGSRDAPPRPRSRGANSIMNYNELSSHLSAREQEHVARMTGAPLLDISNVNKAQPTPV
FT                   NPMGLVGAIDAREREKKTIREGLSNQMVQHAIVQRQQNWQQQQMASNASAAAYNQGSHY
FT                   SLYNMPTANRTWDALNQPYRPDEPRRQSWYGQFASQQAQTPPIYQQNPPYGQHPGYSGN
FT                   ASTLHY"
FT   mat_peptide     join(complement(1016768..1017080),
FT                   complement(1016551..1016708),complement(1013496..1016486))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H1 "
FT   sig_peptide     join(complement(1017196..1017211),
FT                   complement(1017081..1017118))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H1 "
FT   CDS_pept        join(1017660..1017732,1017816..1017973,1018056..1018172)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654282"
FT                   /orf_name="An01g04340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36969.1"
FT                   /db_xref="UniParc:UPI0000EF9E62"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H2"
FT                   /transl_table=1
FT                   /translation="MAEKAEGNESESEGKERQGERYRATQADERWRTINLLTQSKTWVL
FT                   NVVSVTSVTGLIVGSAACFLLSSFETEGEWIWSRREREDIPFERAGQMVKTKPQNNSIR
FT                   HAGWTCGSILG"
FT   CDS_pept        join(complement(1020722..1020874),
FT                   complement(1020571..1020636),complement(1020277..1020390),
FT                   complement(1020142..1020182),complement(1019900..1020055),
FT                   complement(1019609..1019719),complement(1019403..1019510),
FT                   complement(1019096..1019320),complement(1018718..1018775))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877894"
FT                   /orf_name="An01g04350"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36970.1"
FT                   /db_xref="UniParc:UPI0000EF9E6D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H3"
FT                   /transl_table=1
FT                   /translation="MAMSQFRLSIFGVPTVTPVHRTLQDVCEGTGTGSPPPEWGSYCMP
FT                   STRNILGKPITELVHKPKLNCSRLHRVGARRESRRTTLVKIDCIMTTARLILQSCPNDT
FT                   LQGNEDQEKLFPRWVPTAEVILEQTKRGNTLAGGSRAGVCTTECVHPVEHLRVEVRASR
FT                   KGYDLITRGADQPQANAAATLGEAKIADGYSAMSAAEEGPLLINCFARIAGGICFRNYS
FT                   YLYRLGLSCDLEIHSNHCRQFWTFMASREASRQDHLMPCGTAGLWQCASGLLTPGPFLF
FT                   LTVALHSSVHKGQGTRRRLSLPIHPSNRTMIYPRSRTNTFALRGGINWDNPPGHPWVAR
FT                   MAD"
FT   CDS_pept        join(1022402..1023005,1023062..1023828)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877895"
FT                   /orf_name="An01g04360"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36971.1"
FT                   /db_xref="UniParc:UPI0000EF9E6E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H4"
FT                   /transl_table=1
FT                   /translation="MDLICSSPVVPAPIQEMVAEPIDIILDEPTDTCAMVEEKAEEIIE
FT                   AENERLDQLMIEFTRGFDPGTFVDEVSNSLPGILKDIFPGSYEHLLSMLFESDDKMHAT
FT                   QMKLEEWLLKRYPQVLNKIDTERQETNITDETYFGAEIEILRKMLAFLRKESDKPVFWL
FT                   NSRRASPSKAREQLEASIRVIELFKSDVMVAMKLDTEDRKIYNPLPVSTERTALLSIKQ
FT                   LRIDACKASLSWEGYMDSAIVLTSFFHAYKAYTCAHKPDKARAWGWLPPQGLAPPRLSA
FT                   EIAQVGDLVRWEFEHENGAFDLLLKTALWLGLARGLPAVHLFCDVARLFTTHKPSPTAN
FT                   EPYIRFLRHLAQTRVSIAGIKSTPSTPVPFKQSDENTNRGYFEDVVDSDKNLEKDLTKT
FT                   LSLLRINTARDIKLTATPPKCSFRKKAKMIEKACAVEENHTEKWPQKDPASQGNSFS"
FT   CDS_pept        complement(1025298..1026836)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877896"
FT                   /orf_name="An01g04370"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK36972.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329944"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EF9E6F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H5"
FT                   /transl_table=1
FT                   /translation="MSTISARYPSELKTHRCPFDGCTKAFNRPARLQEHLRSHNNERLF
FT                   RCTHDDCDKTFLRASHLSHHIKSAHTGIRDYVCDRPGCGKSFVTGSRLRRHIAAHDGRD
FT                   KYRCTEFPPCDETFRKHSTLQKHIMSVHLKQKPFSCPHIDATTGQKCPMAFDTAGHLRA
FT                   HESRIHTEKRFTCTECTQQAEQANPSSSETPALTTVTFPTYALLQAHIRTVHPPQCPNC
FT                   NLTCSTARELRRHLEVSHGNVSLEERKVFPCTIPGCDSSFTKKGNLTVHIRTVHQGEKR
FT                   FVCGETDLSMSKRVVGWTGADGCGKRYGSKLALEEHIRTAHLGFPNAKAERRQRLGLNK
FT                   TPNPQQTAPSALAALTGEGYAEETGRQITCFIEGCPHRFHRNYDLWVHMGSKHGCTEDE
FT                   IRDMFMQRALLADSNEPVTGDMFGIYGLEFDNDDSSAPYEPYIIHADSKAGLYTMGSGG
FT                   DPTNNENNPGDFPSNFADAMIQDVDVDVSSSSKIPSADDMAMIDPLLAYNMADS"
FT   CDS_pept        join(1027426..1027460,1027589..1027882,1027955..1028074,
FT                   1028146..1028179)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960203"
FT                   /orf_name="An01g04380"
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="RNA polymerase complex"
FT                   /protein_id="CAK36973.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0030880"
FT                   /db_xref="HOGENOM:HBG646526"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="UniParc:UPI0000EF9E70"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H6"
FT                   /transl_table=1
FT                   /translation="MSDYGDHDAEETYDYEPEQEYDDNEPEDFLNPEDVDVAEGGADEY
FT                   GEGSYAPAVNGNHIVASGDPNAGYAGKVMEQTREKKVPNDQRQTTPYMTKYERARVLGT
FT                   RALQISMNAPVLVDLEGETDPLQIAIKELNQKKIPLIVRRYLPDGWYEDWTCEELL"
FT   CDS_pept        join(1028410..1028549,1028641..1028715,1028928..1028974,
FT                   1029311..1029592,1029720..1029792,1029923..1030274)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111069"
FT                   /orf_name="An01g04390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36974.1"
FT                   /db_xref="UniParc:UPI0000EF9E71"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H7"
FT                   /transl_table=1
FT                   /translation="MLTLFRLAQSRPFVRNLLLWKQNDVFTSEPDRALHRGGLGCRINI
FT                   DGWMLWGSDATASMASTPHMAPFPHSRCLAQCVAHEYLLRVIATFSCAVTGYIRSTYQA
FT                   DQQVLTDPWFAHLFFCQPIFIGDDAVLFRDPDPERRPITPRYFNPAFSGLRVSASRGLE
FT                   SSIFLVAADTSRWASPVRRIRTSVAFAKNEQVNGPGTGWTKKKASLCFPQFLMLVFSLL
FT                   QLPDNTSRHVPGEKKELCGSVPRQVTPSLTRNPLVAGPVGSLPTMGHQPEPGSLDCLHS
FT                   HSQGISQHEWPPESGPPYSVLVESAFLAPKLSLSRGLEALP"
FT   CDS_pept        join(1030556..1030740,1030803..1031931)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806945"
FT                   /orf_name="An01g04400"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAK36975.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329889"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000EF9E72"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H8"
FT                   /transl_table=1
FT                   /translation="MGTNADYDEKAVAGSLAANNNGDVHELPTPSDEKPLEEPIFDTGF
FT                   KSWIQVLGSFFLFFNSWGVINTWGAFQTYYEQNLLSNMSSSNIAWIGSLQAFLLMLFGV
FT                   VTGPLFDAGYFRALLTFGSIMLPFGLMMTSLATKFWQLILAQGICIGLAAGCLFVPSVA
FT                   ILPQYFKKRRGLANGLAASGSSIGGVIYPIMFDQLQHKVGFPWATRAIGFLCFGTCCIS
FT                   YSIMRMRFQPTEKRKLVQLAAFKEPHFVMFCIGMFLGFLGFYNFLFYIQSYAIDTGIVG
FT                   STLGFYLLSMLNAGSTVGRICPNFIADHTGPLNVLTPAATATAILAFAWIGVHNAPGII
FT                   VLSVLYGLCSGGFVSLPPVVMVTLTKDIRDLGTRLGMVFAITSVGLLIGTPIGGAILSN
FT                   SGSYLGVQLFTACCLITSASVFAALRFSRSGMRLAARV"
FT   CDS_pept        join(complement(1033154..1033322),
FT                   complement(1032838..1033069),complement(1032539..1032710))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877897"
FT                   /orf_name="An01g04410"
FT                   /product="Similarity to N-acetyl transferase NACTH from
FT                   patent US6017744-A - Homo sapiens "
FT                   /EC_number="2.3.1.-"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAK36976.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG742014"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000EF9E73"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H9"
FT                   /transl_table=1
FT                   /translation="MSSIRRMSPTDLLSLNLTNLDPLTENYDLGFYLNYLMRWPSLFSS
FT                   VQDRQEGIVGYIMGKLEEQPASMRHSEHYTPWHGHITVLTVAPAWRRLGHARRLTERLE
FT                   QGSDINDAWFVDLYVRAGNKVAVGMYKGMGYSVFRRVVNYYSDDPTGFSDSGEDAFDMR
FT                   KPCSRDKKLQHIRDNGEEFLVDPIHVS"
FT   CDS_pept        join(1033917..1034638,1034728..1035301)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210900" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877898"
FT                   /orf_name="An01g04420"
FT                   /product="Similarity to hypothetical protein CAE76116.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK36977.1"
FT                   /db_xref="HOGENOM:HBG329947"
FT                   /db_xref="UniParc:UPI0000EF9E74"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I0"
FT                   /transl_table=1
FT                   /translation="MPSIPPPLTISHRHTRSRSSNIDIDPISPGTYAPNGFSYRSPRSP
FT                   HTPRSSIPSSPVDVRPHHTQSFNGSHRMSGDFGGAGNEGGGLGNLADELADAWEEEEGG
FT                   YGYTSGQDTGAPDAQYVDRSDDEDAYHRMGTGARTPSSGYSSERNSSLQPPRPKTRNGA
FT                   HRHRRHESQYDGSDYGNDSDFEEADMPPSLEMQMAEIESLARRGLENNGSENDFVIQRA
FT                   VEALRDLGGQSGIENNAMRLITAHSSITSHLTHQTRALQTLTHPLLFSPFPLLSSDAID
FT                   ALIPLIDEELLPNLPYPFPEQPRHSSRPTTPSQSPALNPLVSLQTLVSQTSDITLSLRG
FT                   LSDTLYESRQLTSTASRRLRSARELVADLRREEEGVEEGTRWIERGDWDRRLRDREAGR
FT                   VCGDVVSGFEAVCGEWREKLFGAAAGAEVAAA"
FT   CDS_pept        join(complement(1040224..1040265),
FT                   complement(1039869..1040093),complement(1037412..1039786),
FT                   complement(1036821..1037337))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877899"
FT                   /gene_name="tif32"
FT                   /orf_name="An01g04430"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit A"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK36978.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG382149"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI0000EF9E75"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8I1"
FT                   /transl_table=1
FT                   /translation="MPPPPHIKPENVLKRAQELIAVGQAPAALNVLHEHVTSKRTRSSP
FT                   IASLEPVMLLFVELCVDLRKGKAAKDGLYQYKNIAQNTNVGTIEVVLKKFIELAEKKVT
FT                   EAQAKADEIQSSLESAAPSSNVDDLEAIETPETILLATVSGEQSRDRTDRAVVTPWLKF
FT                   LWETYRTVLEILKNNARLEVMYQTTALQAFQFCLKYTRKTEFRRLCELLRNHVQNAAKY
FT                   SAQMHAINLSDPDTLQRHLDTRFQQLNVAVELELWQEAFRSIEDIHTLLSLSKRPAKNV
FT                   MMANYYEKLARIFLVSENYLFHAAAFSRYYNLLRQSAAALAAGQGTKKENPSVTEADMT
FT                   KAASFVLLSALSIPVISTSRSRGALVDVDEVRKNKNTRLTNLLGMASPPTRAVLFKDAL
FT                   NKGLLKRARPEIRDLYNILEVDFHPLSICKKITPILKQIGADPEMEKYVLPLQQVILTR
FT                   LFQQLSQVYESVELKFVYELAQFPDPFQITPSMIEKFIMNGCKKGDLAIRVDHISGVLT
FT                   FDTDVFSSAKALHPGSAAGSAESEVGSVQRLQNTPAEIARLQLTRLAKTLHVTCMYVDP
FT                   SYNEARLQAKRAALARAEAGAAKEHEETLARRVIIEKKKEAATDALQRKQREEETRKRI
FT                   RTQQLQEAEKQRLLDEHREREKKRIKDEQDRIRQQELKKQLEELKTGVKGIDISELDLN
FT                   ELDANRLRAMKLAQLEKEKNELNDRIRTTAKRIDHLERAFRREELKHVPEDYEKQKQRD
FT                   MEIYEATKAEALKEAEDKHKEAVALKHRLSRLVPQFNSFRKEVSEKRHEEFEKRRKAAE
FT                   RDFEAKKMQRIKEVQERRRRERAEREEEERRRKEEEERIRREEEERTAKEEERRRVLAE
FT                   EKAKREEERKRLDELAAKQKQREEEAEARRAARRTGGAEPEAAPERAAPTERTAPRLNL
FT                   APRTGGAGPSWRERQAAKEAAGGTPAAPAAAAPEPAREEPAPVRRTGGYVPPHLRSGAS
FT                   ATPAAPAPAPSTERYVPRAMREAGSSQPPSRTQTPGSSSDKPEESKPAAGKWVPRWKQQ
FT                   QGGQ"
FT   gap             1042011..1042110
FT                   /estimated_length="unknown"
FT   CDS_pept        join(1043357..1043428,1043560..1043629,1043717..1043788,
FT                   1043878..1044089)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000275576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806946"
FT                   /orf_name="An01g04440"
FT                   /product="Similarity: the C-terminal region of the
FT                   predicted protein shows no similarity "
FT                   /function="selenium binding"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAK36979.1"
FT                   /db_xref="GO:0008430"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG553736"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000EF9E76"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I2"
FT                   /transl_table=1
FT                   /translation="MHNHLPRITIKYCTQCKWLLRAAYFAQELLSTFSTQLGEVALVPA
FT                   TGGTGGEDVDITGTILWDRKTNGGFPEVKVLKSLVRNVVDPSRDLGHTDRALRAANVPV
FT                   QSRDGDEKVVGKSQEQESTTAAAATATKGEEKCEECQ"
FT   CDS_pept        join(complement(1046711..1047716),
FT                   complement(1044657..1046644))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878862"
FT                   /orf_name="An01g04450"
FT                   /product="Catalytic activity: guanosine 3' "
FT                   /EC_number="3.1.4.17"
FT                   /function="3',5'-cyclic-nucleotide phosphodiesterase
FT                   activity"
FT                   /function="metal ion binding"
FT                   /biological_process="signal transduction"
FT                   /protein_id="CAK36980.1"
FT                   /db_xref="GO:0004114"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG323890"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="UniParc:UPI0000EF9E77"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I3"
FT                   /transl_table=1
FT                   /translation="MDGIECSAIYIDHRVRSERWVYQGTPEAPAGAESDSGIIEEPESL
FT                   SSDVQVLLGVCKRIYLCQVGTAIANKLAEISDGAQSRCTPIFVFFDIDIHGEEAALQRR
FT                   RASRGSWPDVSPPSPASLRRGFTFTSQWEGAYDLKLLSGLSADIQVQDGPNVIVPVAVL
FT                   RPPFADPTSASPADQPRIPSFPDPQHISKCLDAGAVDVLVTPLDSCRAQALVVQAYRTR
FT                   KTALREQSRFLSRKKLRKHSWVGVNDEQPYAYLREAMVSKLMRGICNPEEVIEEFQDRE
FT                   LDVRPDRADFVREHIAQWGFTAHEFSDDELVLAAFEMLQHALQYPELEQWQLTPGELRT
FT                   FLLACRASYNSFVLYHNFRHAIDVLQSVFCFLLHIGALPPYGPNSPTIDDKCPMASLLT
FT                   PFDTLTLLISAIGHDVGHPGVNNFFLVKLNAPLAQLYNDNSVLEAFHCAAFSQILRRYW
FT                   PTAFKDRQLRKLLISSILATDMGVHQKFMERLGSLQEKFHENNRTVDGWKPQDLELYKT
FT                   LLCGLLIKCADISNVARPWDVAEKWTQILQEEFANQGEMEKEVGMETALFGGPPELGNI
FT                   YKLATGQIGFMSIFALPLFEGVSDILPDLKFTVEHIRSNQSKWHFLADMEKNRQTLQID
FT                   LRPDDLVSPRTQSPIPSLRGLHAPLAINSPKMPIKPALPTSEPVSQRSTADDYFGTAST
FT                   PLASDDSPSDYNENTISPVVSPDTPGPPMDITGCSMPSPDEAASRRSSGVIPEGQTNSP
FT                   SARLSDNMDGCSDAIRASSDPTVLAAVLFANGSAAGNGDTSGRSSARNSSVEGRPSSSR
FT                   HGPPSGRRQHANTASSGRTSGPSNSQRNSCTRTHSVSTYSNNMTPISPSTNATSFLSVD
FT                   SDEKGFPRESISRSDGEWDRANTRPATSNHPSVNAAYPSTRRASDPHNYDAAKVTSPVG
FT                   YGTSSSAQSTTTTGSMKHEGRGPRWDEHGSKEHAPPRKLPKRRSRLRLAFWKRRTHHSH
FT                   QHEVSGET"
FT   CDS_pept        join(complement(1048625..1048657),
FT                   complement(1048441..1048508),complement(1047772..1048021))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878863"
FT                   /orf_name="An01g04455"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36981.1"
FT                   /db_xref="UniParc:UPI0000EF9E78"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I4"
FT                   /transl_table=1
FT                   /translation="MCRDLSVFPRWPNFYQSLRHLALLLTSVDPLPHLTQFRIQLYNVT
FT                   DRKSLLFFFTSTFSTLLRSSLYPYTGRSFLPEISRPSHSTCTTISINHMNPSSDRLGCY
FT                   LFSFHICCCPET"
FT   CDS_pept        join(1048867..1048879,1049019..1049216,1049355..1049471,
FT                   1049745..1049794,1050012..1050128)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878864"
FT                   /orf_name="An01g04460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36982.1"
FT                   /db_xref="UniParc:UPI0000EF9E79"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I5"
FT                   /transl_table=1
FT                   /translation="MVRPVNHFSEIEGKEKRGIKYEISRSWWWWSWGNQGEKGPKDQRV
FT                   RKLEIREDVKRGDTGDVKGTVDGAEMVVVRNQAKGREKTEKEEKEEDGRGEEKRKKTLE
FT                   TRGRREALRHGRLASSSSDPIEDGDDLTMQSTPPTSDGGCLGAEQINPGLDTYFVTRVE
FT                   S"
FT   CDS_pept        complement(1054041..1057907)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210867" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878865"
FT                   /orf_name="An01g04470"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK36983.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329950"
FT                   /db_xref="InterPro:IPR000949"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI0000EF9E7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I6"
FT                   /transl_table=1
FT                   /translation="MYCVRPVLTKKPARGFAWACAACSRAQERKLEARNTPILGENQPE
FT                   ADEEMVEEEEEEPHGATNGTTSSTPAPVEEEVRPATEEQVAQARMWPYRYLGIHCRVED
FT                   ALDYDDRIYPRASSRLGPRHQAMVNAWPGKPVEYVKPIDIKKKYMRGSGGRKDSKLTKE
FT                   TVAAIEAAKQEKANRPKWVMDEPLGYVRRGEDEPVTVGGKQVRTAELMFKMPTADQVPS
FT                   SRGEDDAPGSHLSPAEREKFVDDYMERAKALAPQLGEEKYATNFLDKALELLYSNSFDA
FT                   DAALAKLKTMNKYKDLKEPHLRPEELKLFEQAVSKFGSEWRNITKYVGTVPHYQIVRFY
FT                   YMWKKTPRGRQIWGAYEGRRGKKEAKRSSAAKLVDDVADDHDDSAFDNDKAAEKKRGFQ
FT                   CKFCSTRTSRQWRRAPGTAPGTTTSSEPASKQRDKGSQLTVALCLRCALLWRKYGIQWE
FT                   SVDEVAKKIAQSGNKSWRRRVDEELLTQLLVSTETPISINSATAATAASIGVPVNANPQ
FT                   VQQETTKKKGGRTTEKDSAATSTATSVEPAPKKKVAADRIPEPPPIVPDPPRAKTLPCS
FT                   ICNKMEPEGDQHLSCRDCRLTVHRSCYGVSPSRNCVKWLCDMCSNDRDPMISTTYECVL
FT                   CPVTWTEHELMEAPRSTHKKKTERDREKERLEKEMVNEAIKLYRQRQEAVGKPIGPREP
FT                   LKRTAGNNWVHVTCAMWTPEIKFGNAKELEPAEGFGLIPRDKWRDVCKICKSDKGACVP
FT                   CHFNNCNARFHVGCAFQAQYKFGFDITPIKSSRRDTVNSVRLGEEVGSASAGIWCSHHP
FT                   VSATIHEIGEPTEEEGVNALRRYAEAYKQADLTLTGTIRKAAYVQQLINVSHQTATPSA
FT                   NRRVSSVHSVTAPPVVSAAPAAPAASTTPKDGHKTPEDAPDEMVIDSENHAPRPVADND
FT                   VTRKCARCSSSFSPRWWPLDKSRRTTGVDHRTPLLNGVGLNDPVGSRFSTASASPPYPH
FT                   QTPSQHALPRLNGEYSPEKTALSAINSEGPQTLYECHKCHLKKPVTQAQPSPEPRPSPY
FT                   SAQRPVLPAPKLTEYHNHPFGNHHRHPPQSGVLPRPIGLPHGGSEWHPSYEQRPADFGD
FT                   NKLRNGLPVPGYRAAAPPPPPPPAHHMNGFPPTPSHHAPPLSHYPPGSHAPPQPFPTHQ
FT                   SPYGPVSMPSPHLSHAAGPRPYAPSASPPDVHATMVRHSPQHSLSALNGGPPPRVYSVD
FT                   RVLGAPAQSPPVSQAHMDPRGPTPPVKPEDTPVIPSAARHTTASGTNGGSGASASPSLK
FT                   NLLS"
FT   mat_peptide     complement(1054044..1057829)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I6 "
FT   sig_peptide     complement(1057830..1057907)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I6 "
FT   CDS_pept        join(1059468..1059627,1059804..1059909,1059980..1060123,
FT                   1060216..1060398,1060480..1060544,1060643..1060697,
FT                   1060777..1060905,1061076..1061181,1061357..1061434)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878866"
FT                   /orf_name="An01g04480"
FT                   /product="Similarity to gravin-like gl - Xenopus laevis "
FT                   /protein_id="CAK36984.1"
FT                   /db_xref="UniParc:UPI0000EF9E8C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I7"
FT                   /transl_table=1
FT                   /translation="MHLRRGWFAFGCPQDRKSKGNTKLDGDDAEMQSSATGRDGETIPH
FT                   EKWGTLQPAACLSGLIPSVLPARAPKGSRLVGVKMGKNWDTPTGITKEQQEAGRKQTGG
FT                   GEGLPNCMNDEAKRRRGKKECRREEGKRGREKRLAAVEAKQAVEPLRALGDSWGEHRIR
FT                   SVLAPAASQISPVGGGGRKVRPQESYGISQSVRNVMMYAEPGLPKHGSKAQIHTDGEGN
FT                   GREEREEGRGRKKKDDQQLNWQVFRNPEGNASQKSERKKDRQMEMQQQPSRVEEEKESD
FT                   RSIGPSSYLRIPIPAISTHAWLQPALIPGPDGSTQHLAPLARPGGGVFDPLGDLRRDAE
FT                   F"
FT   CDS_pept        join(complement(1062648..1062897),
FT                   complement(1062262..1062398))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878867"
FT                   /orf_name="An01g04490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36985.1"
FT                   /db_xref="UniParc:UPI0000EF9E8D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I8"
FT                   /transl_table=1
FT                   /translation="MDRRSKLKDGEKGESGTMFQPRSPSGWPPAHCRVASAADVVNALR
FT                   LRDFIHDVAAAVAAANTIDQLPYPKKLILLDKDSAHIRFFPHMNKKTILRKETARRRTS
FT                   DRFLSCPADPAPGYDADAVSVVLD"
FT   CDS_pept        join(complement(1063989..1064071),
FT                   complement(1063764..1063916),complement(1063262..1063481))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654547"
FT                   /orf_name="An01g04500"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36986.1"
FT                   /db_xref="UniParc:UPI0000EF9E8E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8I9"
FT                   /transl_table=1
FT                   /translation="MGGVNHVAWVKGKGRLPALLRAVMWQQKSFQGPLVARRPGMPSCW
FT                   AYRDDGDDVTQASSKLIYLVKYGNSDYHSSRHLGPGAKGWAKFPLWWTDYCYHHLIAVA
FT                   GPHAPTSAVSCSTATSAVNWISFPSLPRVLERLVPARLVSRARITRK"
FT   CDS_pept        join(1065585..1065598,1065667..1065799)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878868"
FT                   /orf_name="An01g04510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36987.1"
FT                   /db_xref="UniParc:UPI0000EF9E8F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J0"
FT                   /transl_table=1
FT                   /translation="MPVGSRASSPATLAYSPTFSLQSARGTGRNSVAAGFFPTSVPPDW
FT                   VAG"
FT   sig_peptide     join(1065585..1065598,1065667..1065730)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J0 "
FT   mat_peptide     1065731..1065796
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J0 "
FT   CDS_pept        join(1066791..1067426,1067505..1067594,1067651..1067833,
FT                   1067890..1068370,1068421..1068592,1068644..1068805,
FT                   1068859..1069305,1069361..1069802,1069838..1069966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210856" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878869"
FT                   /orf_name="An01g04520"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK36988.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG329955"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0000EF9E90"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J1"
FT                   /transl_table=1
FT                   /translation="MSAPPGQPFQTYGFQTSVDIARQRTFEVVPLAGNKRPPDPSADDD
FT                   HRPVGVKHPTTAPGAVGRSVDFIRPSFILPKARLVASDIYPVAETPPVCRGQQPNVFPT
FT                   DHDPAHNPYLSLNHPTYGLPPGLVANFAAAGLSSIYQWQASCLLAPGLLKGDRHLVYTA
FT                   PTGGGKSLVADVLMLKRIIENPGRKAILVLPYVALVQEKLKWLRRIVQDRSIRVTGYYG
FT                   GSRTAASWADTDIAVCTIEKANSLINSAIEECSIGDLGVVVLDELHMLDDEHRGYLLEL
FT                   MVTKLLLLRQRTQIIGMSATLSNTEMLAEWMNAAYFVSTYRPIPIDDYLVYENAIYPAA
FT                   TSRQLFQTISKLKSMSNATLMERMPPDRVIRPSTFRELANPMTNATVALAIDTAGAGHG
FT                   ALVFCGSRHMCQIQAVVMSEAMPAPADNTDELTKRLDLLAELRSLPSGLDPVLEKTLVR
FT                   GVGFHHAGMTAEERELIAQAYDQGVLRTLIATCSLAAGVNLPARRVIINGARMGRELVG
FT                   PAMLRQMCGRAGRKGKDDAGETYLICGDSDLQAVCDLLEAEMPAIESCLAPEKRGLKRA
FT                   LLEAIATGLVSGNDAIKEYVRCTLLYLTVDKKVAYAIMGSALQELATEGLVQLNDDESY
FT                   SSTQLGQAVVASAFAPEDGLFVFEELKRALQAFVMDGDMHIFYLFTPLQAATATPIDWL
FT                   IFRDQLDNLDESGLRALQFVGVSPGFVNTMAQSGASLKENTPEQMNQARIYRRAYTAFQ
FT                   LRDLSNEMPLSAVANRYRIPRGAVQTLAQQCHGFAAGIVKFCQRMNWGMLAAVLDHMRD
FT                   RLEAGARADLLEMAQVTYVKGWTARLLRENGFRNLRALAEADAKDLVPILMMVWQTLMA
FT                   VNPRKTQKNQLHPAEAERYAKKLLAKAEVIVASANKIWGTYG"
FT   CDS_pept        join(complement(1070748..1071294),
FT                   complement(1070331..1070692))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190226" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878870"
FT                   /orf_name="An01g04530"
FT                   /product="Similarity: strong similarity to A. niger EST
FT                   EMBLEST:BE760850."
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAK36989.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="HOGENOM:HBG331580"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI0000EF9E91"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J2"
FT                   /transl_table=1
FT                   /translation="MMFPPSILFGLAVGIASIVPTIAQSTCNGQAEYCDRRFSNVTQVG
FT                   AHDSPFVGSLLSDNQDLSVTQQLDLGIRFLQGQTHKSELDDTILLCHTSCLLEDAGSLE
FT                   SFLTTVKTWMDSNPDEVVTLLLTNGDSLSVSQFGDVFNSSGISDYAFVPSSSPDTLAMD
FT                   EWPTLRELIGNGTRLVSFLDYGADASTVPYILDEFAYFFETPYDVTNATFPDCSIDRPA
FT                   GASASGRMYIVNHFLDVDILGILIPDKDHASDTNAVSGSGSIGAQADLCYSIYDRLPNF
FT                   ILLDFVDLGEPIAAQSELNGV"
FT   mat_peptide     join(complement(1070748..1071225),
FT                   complement(1070334..1070692))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J2 "
FT   sig_peptide     complement(1071226..1071294)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J2 "
FT   CDS_pept        join(1072154..1072341,1072637..1072969,1073026..1073425)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654548"
FT                   /orf_name="An01g04540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36990.1"
FT                   /db_xref="UniParc:UPI0000EF9E92"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J3"
FT                   /transl_table=1
FT                   /translation="MDKESPMLTSAFATFDSSATESIPAINLRNIKYWEIGRCDVSAEL
FT                   MNWMSLPKPSTWNSINRVYQEYQEYQLLLRRWVSPVSLPGRSFSIASSSPVQSKLVAAS
FT                   SPSLDPFLTPFGIISSLPEQLVRLLAVLSPSVCRRPEPDIQPPVDPGQPPLLLPHSSFV
FT                   TSIVETTSASPWSDGHSNIPPMSSMIETSNDWAREDELDLGQEDDEHSPPARNGVSDHV
FT                   NTQEPPDHGPMAYFEEDLPGVASENHVSGKPSPPVDADSTDLPSSPQSGQPGAPGSVDE
FT                   TLSTPDDTPSLHVGRDYVCSALTPR"
FT   CDS_pept        join(1073768..1073870,1073927..1077688,1078042..1078190)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878871"
FT                   /orf_name="An01g04550"
FT                   /protein_id="CAK36991.1"
FT                   /db_xref="HOGENOM:HBG329957"
FT                   /db_xref="UniParc:UPI0000EF9E93"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J4"
FT                   /transl_table=1
FT                   /translation="MVVSTSIVVGTSKGIILVFDYQQNLKTIIGLGTKAVECGAITSLA
FT                   LSADHSTVAGGHTSSDIFTWEISRSARPFLHIPPIPASQVETRTSDGHIAGGPVIHVGF
FT                   LGTRRTALVSADKRGMAFSHLATRGMGAMGRTVKTTRILGRYPQVFAEGSRPRKPSSVL
FT                   AFSPLPLGNVEQSTDSLGLVAMLTPYLLVIVSTTPVAQTQHKSPRPKEVTAHGAMTGAL
FT                   AWFPAIRLKGKDSEISKTKLVYCWSNVLTVMDISEVETDESPSRDRPPSLSFRPRSRWK
FT                   ADEAIVAVQWLSRSVLAVLTITQQLLILEDHTMRVTEAVDLLNRHIYHVDLFSAQLHSL
FT                   VEQFNEEDTSMHGVVADAFYMSFRSYKGRLFLLGFNEMLMGSLSNWADRLLALMEAGDF
FT                   IGAIQLATSYYEGSAEKLTIELPEEDALRQPLVREKLQEMISASLKYAFGRNTEANSGR
FT                   LGNGQLEKLAEVSIAACVCMSEEDFLWDEVFTWYEESGSPGIFLDALEPYIVEGTVRSL
FT                   PPTAVKALINHFATNHSVSRLEEIICLLDTATMDIDQTTSLCKHHNLYDAFIYVWNRCL
FT                   GDYVGPLQELLQLIPTPEALVNGESVDGLKRYTNAMKMFPYLSFVLTGRVYPTGTDMDD
FT                   AEATRAKATLYDYLFSGKPSGTKAGARAQLGGSFPELQAMLRFDTSSFMSMMNEAFEDS
FT                   FLNEQEPDETPVRGVSINRQYLISILLQVMTQSFDASDTIYLDMFLARNLPKYPQYILL
FT                   PGSTLHQVLERLCRYPSLDMADDCELSAEYLLSFYHPPNVQGMIPLYKEARFFRILKAT
FT                   YRSEKQYPELVRTYLEDPNEQEAIFTCLQDCLRPGSGLGKKQRRDVVDVVKEHAGQLVA
FT                   IDVEKAAQTMHGLAPDIHGTFLNILKDDTGRQYQYLGVVVRMSLQSVTEGRQSKPIENW
FT                   MVERYVQLLCKYNPSRVADFVDDLRVGDVRLEELLPSMEESGVVDAAVILLARQGQVRA
FT                   AMDRLITHLGTLESGLVGILQNLHDSPDSASTTEAIDHLVESLDKFTRVGTWLCQGQSK
FT                   TAKNSRAVERNGTGKGVLEQPLSFDESLWLDLIEAVVRTASSVFGLMQQERAAPVTPAT
FT                   SHLMSAFRALVQQVFTSLLSSTVRVGGSSSSERSDVSFLRILRAFLTRAASWSPSLLEL
FT                   RAVLASIFSAYTYEKSLLALANGMLDRDLFVHVDEVTRLRQRGWRPRGQVCEICRQRIW
FT                   GPGVGPQFWQAWEQKQEKTHEQRLQKRLHAQHDPATARGKGKAADAGQPLPLMDGHAAA
FT                   ADGEVLAGSADRGRQIPTSCQKGHWKRQKPNNVGEWHSSFCIRAGISSADAAG"
FT   CDS_pept        join(1079026..1079396,1079478..1079904,1080000..1080500)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960441"
FT                   /orf_name="An01g04560"
FT                   /product="Function: mixed-linked glucanases "
FT                   /EC_number="3.2.1.6"
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /protein_id="CAK36992.1"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG737844"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI0000EF9E94"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J5"
FT                   /transl_table=1
FT                   /translation="MLVAMRRTATLLSALGLTAQLSSAAYTLQDDYSGSGFFDGFSFFT
FT                   DTDPTNGFVDYVDEATAQSNGYISTSGDYVYMGVDHTNVAGSSGRQSVRISSDATYNHG
FT                   LFILDLEHMPGGICGTWPAFWLVGADWPNNGEIDIIEGVNQQSGNDMTLHTSDGCSISS
FT                   SSDFTGSMTTDNCYVYAAGQSSNAGCGITDPDATSYGTAFNANGGGVFATEWTSDAISI
FT                   WFFERGSIPDDIDSGNPDPDSWGSPVARFQGDCDIDSHFDGLQIIFDTTFCGDWAGNVW
FT                   GSGSCASVASSCSSYVANNPGAFVDAYWSINSLKVYQDDGDSTVAGVVDYGDDDDEDED
FT                   DDQDDGDDDSDDDDDDDDDSDSDDDSDDDGDDDDDDDDDDDDDDEDSRPWRGGRNHHGQ
FT                   MLNASTSTSSFPSPSFVKKARWEPRNYMAGMIF"
FT   sig_peptide     1079026..1079097
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J5 "
FT   mat_peptide     join(1079098..1079396,1079478..1079904,1080000..1080497)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J5 "
FT   CDS_pept        join(complement(1084201..1084244),
FT                   complement(1084063..1084121),complement(1083685..1084007),
FT                   complement(1083215..1083628),complement(1083013..1083159),
FT                   complement(1082536..1082966),complement(1080911..1082486))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210834" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878872"
FT                   /orf_name="An01g04570"
FT                   /protein_id="CAK36993.1"
FT                   /db_xref="HOGENOM:HBG329958"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniParc:UPI0000EF9E95"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J6"
FT                   /transl_table=1
FT                   /translation="MVFLSAETGLKAAVGVFLLSCTFISTSYKTTFAFDHPLITAVLAC
FT                   YFAGICLLILSRFIHRIPKIASSAPKYSAIPLTERDQTLEEPFSPISLDSNSSFALTRS
FT                   RSSARWIKLGLLSVLGCIRIALYRDLTFHTECAPDGYAYSIPFLLALYDYWRNQRNRPV
FT                   AKWSAPERPQNAHLRAVATFASRMHNFLFQSRLRYVIAAFFLLTGGYITITFSHGLQST
FT                   YICPNTSSVYTRMRVFTIFSLILDSLILIGAAELASEGSRSGDTIRKPPLASWAYSLLG
FT                   VAIFYTIVVIILVATSDGDDRFISAQYLRSAVGQAVLVTCVVAAASQLIPYYGIAGLAV
FT                   LAGFVTLYFTWASTLFNGQHPFPLIFASRAFAALFFIFAGAVAFLYARTASEDEAQFLY
FT                   RFNLAMRITFAFLTVIGLVLVHQQHSAAHLHPIDLLVYDGRQHHDQWLARANSSQTLTD
FT                   AVRKYRAQYNQHPPPNFDKWYEYAVNRSSLVIDEFDQIYADLLPFRALPPAQIRDMTQK
FT                   LATNPYNEIGAISIRNGKARVQEGIKPTHAWMVISASKMIEKFAEFLPDMDLAFNLNDE
FT                   PRVSVPWEKVSVLRHQARSYGLPPEDSIQTEWSTDRGAQWGPIEPADQTTETMFVDNSF
FT                   KHIFDRYVSSTCPRSSKARSQRIWDRRHICLSCVRPHSLGEFPSDWTAATDICHQPDLA
FT                   SLHGFFLSPASFKVTQDLTPVFSQSTIAGFNDIIFPSPWNYVDKIEYKPSEEHPDANYT
FT                   DKTNTLFWIGSTSEGVSNHGEWKGIPRQRLAHLVNNNTLNSVSVFLPTNETDTYMYEVL
FT                   NGRAPSDILHLDTSVNVIDPIVRCRREDCDDQSKELGAASRVDFQSHWQYRYLFDSDGA
FT                   GFSGRFLPFMQSHSLPFKTGLFRQWFDSRITPWLHFVPIDLRLHGLWSTLAYFAGVDTT
FT                   LTVNGATRHVHMPPHDIEGTWIAEEGRKWANRVIRKEDMEIYFFRLLLEWGRITDDQRD
FT                   VLGYRLDM"
FT   mat_peptide     join(complement(1084063..1084066),
FT                   complement(1083685..1084007),complement(1083215..1083628),
FT                   complement(1083013..1083159),complement(1082536..1082966),
FT                   complement(1080914..1082486))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J6 "
FT   sig_peptide     join(complement(1084201..1084244),
FT                   complement(1084067..1084121))
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J6 "
FT   CDS_pept        join(1086015..1089013,1089103..1089310)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210833" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878873"
FT                   /orf_name="An01g04590"
FT                   /product="Function: KRE33 of S. cerevisiae "
FT                   /protein_id="CAK36994.1"
FT                   /db_xref="HOGENOM:HBG329959"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="UniParc:UPI0000EF9E96"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J7"
FT                   /transl_table=1
FT                   /translation="MPRKAIDSRIPALIRNGVQEKKRSFFVVVGDRAKDVIVHLHYIMS
FT                   SVDVKQNKSVLWAYKKDLLGFTSHRKKREAKIKKEVKRGIREPNQEDPFELFITLNQIR
FT                   YVYYKETEKILGNTYGMCVLQDFEAMTPNLLARTVETVEGGGIVLLLLKGMNSLKQLYT
FT                   LSMDIHSRYRTEAHDDVTARFNERFILSLGSCDSCLVVDDELNVLPISGGKSVKPLPPP
FT                   ESIDDTNIGTKKELKEIKESLAESQPIGSLVNLARTVDQAKALLTFADAIAEKTLRSTV
FT                   ALTAARGRGKSAALGVAIAAAVAHGYSNIFITSPSPENLKTLFEFVFKGFDALGYLDHV
FT                   DYTILQSTNPDFNKAIVRVNIHRQHRQTIQYIQPQDAHVLGQAELLVIDEAAAIPLPLV
FT                   RKLMGPYLVFMASTINGYEGTGRSLSLKLIQQLREQSRGGVKVSGEDDIDVADRATGKA
FT                   AKNIDKSLAGRSLREITLSEPIRYAPGDSVEKWLNKVLCLDATLPKSRMNTQGTPHPSQ
FT                   CQLLQVNRDTLFSFHPVSEKFLQQMMALYVASHYKNTPNDLQLMSDAPAHQLFVLVPPI
FT                   DEEATKLPEPLCVIQVALEGRISRQSVLNSLSRGQRAGGDLIPWLVSQQYQDEDFAGLS
FT                   GARIVRIATNPEYLSMGYGSRALELLIDFYEGKFTSLSEDIPEPQEEMVRVTDEELTNS
FT                   NLLDDNVKVRDIHTMPPLFGKLSERRPDALDYVGVSFGLTPSLHKFWKRSSFSPVYLRQ
FT                   TPNDLTGEHSCVMLRTLTSGSNDAAWLGAFSRDFHKRFSSLLSYQFREFPSVLSLSICE
FT                   SANSGAKLDPSISQSPLTKAELDAAFSPFDLKRLDSYANNLLDYHVILDMVPTIAEYYF
FT                   SGRLSGKVSLSGVQQSILLAIGLQRKNLDTIEKELTLPSSQLLAMFLKIIRKVSTYFRN
FT                   LIEGAVAETMPAEKAPSARVTTEAHDELPDERFKPLETSLDDELREGGQEVNEELREKQ
FT                   RALIDALPLDKYEINHGSAAWEEAEKQIRSGGASTVSVKTSKQTKRKKGESAREIYDQE
FT                   IDSKRQKIIKKGTEGKKKKH"
FT   CDS_pept        join(complement(1091082..1091234),
FT                   complement(1091013..1091020),complement(1089714..1090947))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654549"
FT                   /gene_name="prpA"
FT                   /orf_name="An01g04600"
FT                   /product="PDI related protein A prpA-Aspergillus niger "
FT                   /EC_number="5.3.4.1"
FT                   /function="protein disulfide isomerase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAK36995.1"
FT                   /db_xref="GO:0003756"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG329960"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000006BCA8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J8"
FT                   /transl_table=1
FT                   /translation="MLQPSSALLFVTSLLAALPVNADGLYTKKSPVLQVNQKNYDQLIA
FT                   NSNHTSIVEFYAPWCGHCQNLKPAYEKAATNLDGLAKVAAVNCDYDDNKPFCGRMGVQG
FT                   FPTLKIVTPGKKPGKPRVEDYKGARSAKAIVEAVVDRIPNHVKRATDKDLDTWLAQDEE
FT                   SPKAILFTEKGTTSPLLRALAIDFLGSIQVAQVRNKETEAVEKFGITEFPTFVLLPGGG
FT                   QDPIVYDGELKKKPMVEFLSQAAAPNPDPAPKGSTAPRDNNKKKSTEPSPDSKIVSDEA
FT                   KPASVPIPAPPIGTLPTAEALEAACLMPKSGTCVLALLPEPSEPDAELPAPAKDALLSL
FT                   AEISHKHAVRKSKLFPFYSVPAINSGAKTLRAGLGLPEDNSVEIVAVNGRRGWWRRYDS
FT                   VEGAEYGQERVEAWIDAIRLGEGEKQKLPDGVVVEEVVEEKVEEKVEEVVEEPVEEKPA
FT                   VDHDEL"
FT   mat_peptide     join(complement(1091082..1091168),
FT                   complement(1091013..1091020),complement(1089717..1090947))
FT                   /product="PDI related protein A prpA-Aspergillus niger "
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J8 "
FT   sig_peptide     complement(1091169..1091234)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J8 "
FT   CDS_pept        1091764..1093311
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878874"
FT                   /orf_name="An01g04610"
FT                   /product="Similarity to hypothetical protein CAE76271.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK36996.1"
FT                   /db_xref="HOGENOM:HBG329961"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0000EF9EAE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J9"
FT                   /transl_table=1
FT                   /translation="MSIASPSEGKGMALLPREIFWLVLKHLEPGDVLRCRRVCQSWNVA
FT                   FRIGANLLPMLKKRYPLAREVRQLDSESAESLETPEYDVRISQIFDKVTAKYDYLSRVT
FT                   PQTMHRLKLCDDFGITGERNWFPVQPWEYHASHLMQRIDRPFGETFWSYDDGLLVYPSA
FT                   DHSCLVLMDMETDRKFMVPFMIVGRVIRRVRLQKRVLVIEWAENKAYHWLNDSDGVHRH
FT                   FATSFDVNQKEDGWRVNFRNEWKIMFLGHPLSERDRFYSTHTQTHYAIYIWQPNRSLYT
FT                   ADEDAPIESLSVWDISKPSDYRPSLDPTGRLRVESGGGEEDLGPTIITRFGFRELGFYG
FT                   VRQRGLPAIQSLNITDDDQSIEILEGTCAGRSPQVLVPDEWESEVWVTTIPIVGEGPCR
FT                   RRRADFPLPPYRGNCSLQTNPITFAICDEPWYSIVCESYDEQSQVGYCLYLEEQIWPVE
FT                   TAMFLAVGSPEYAPEPANVLPESLVMELTAMGKVCGTEDYLIGQSHNRELVIFRFDR"
FT   CDS_pept        join(complement(1095281..1095445),
FT                   complement(1093500..1095152))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878875"
FT                   /orf_name="An01g04620"
FT                   /product="Function: the DnaJ-domain is part of a chaperone "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAK36997.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0000EF9EAF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K0"
FT                   /transl_table=1
FT                   /translation="MYSAARVTNYYSILGISHNSTLKDINSAYKKLALKHHPDKQGTGS
FT                   ADVSNDEFQKIQEAIETLRDPIRKQEHDDSLRRAGYYFHSTPFASDDEYEDWEKGTWRP
FT                   TSGKRYCDLTDPMELYKYKYGHSVHMDPFAPESLVEKARVEIEIRVGEQLKREAEAAEA
FT                   AAAAGGMRSGNGDDEGEEDEGVEDDGGVLFEKPQHFQDILEYLRNQEAASVEKRKMAMK
FT                   ANVDKDEERLRNGEDEEEFEHDEKEFARGYGNEYCWRSQEAGPDVPREWHENFYYNEEE
FT                   AAYYGGDEDEGEGEGDEEEDDEDDEEDDEEEDDNRRGENQNDDFEDEDEDDEQPQGPGA
FT                   GAPTQHHGNSYDVDRYDDDGYYHSDEEDDCYDDGGHNNGADIYFFKFSHTASEQPASSC
FT                   SDSTEYVTAKCARESDDESVLDEAGGVCVTHYMSNKPQPTDSSIFSPSSINLPSSPSVM
FT                   PLLTSPSIKLNATANINNGDPLLFHFYSKLDDPGNSYTSQDFVFELTGMVFDMYCGWLE
FT                   CVRLTFPEAKPLTKEQQDTSACLHLGGWEKRFGRDKCKGCHLRQPLYMLNCPGCGIEKC
FT                   VGCRLTAAAAVGKGVGDLLEGWDVTALGW"
FT   CDS_pept        join(complement(1097153..1097208),
FT                   complement(1096379..1096953),complement(1096207..1096319),
FT                   complement(1096127..1096147),complement(1096040..1096074),
FT                   complement(1095895..1095988))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000215911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878876"
FT                   /orf_name="An01g04630"
FT                   /product="Complex: more in detail "
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAK36998.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG586593"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="UniParc:UPI0000EF9EB0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K1"
FT                   /transl_table=1
FT                   /translation="MFSRAVRPAVRAGSIAVSRTAPPNAANFATLREIEGRLKSIKNIE
FT                   KITNTMKVIASTRLTRAQKAMEDSRAYGQTSNTVFENAETKPLEDKKTLLVVASSDKGL
FT                   CGGIHSGLSKATRRMLQQYPDADIVVLGEKAKAQLSRTNPNAIVLSFANVCKDIPTFND
FT                   AQSIADQISQLPTDYASVKIIYNQFINAQSYEAGTVEAYSEEAITQSPNLSTFETDDQT
FT                   LAHLREYALANNLFWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQAAIT
FT                   GELVEIITGATASADM"
FT   CDS_pept        join(1098217..1098271,1098457..1098674,1098770..1100326,
FT                   1100377..1100616,1100686..1101135,1101192..1101326)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878877"
FT                   /orf_name="An01g04640"
FT                   /product="Catalytic activity: ATP-independent breakage of
FT                   single-stranded DNA"
FT                   /EC_number="5.99.1.2"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="DNA topoisomerase type I activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="DNA unwinding involved in replication "
FT                   /cellular_component="chromosome"
FT                   /protein_id="CAK36999.1"
FT                   /db_xref="GO:0003917"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006268"
FT                   /db_xref="HOGENOM:HBG521929"
FT                   /db_xref="InterPro:IPR001631"
FT                   /db_xref="InterPro:IPR008336"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013030"
FT                   /db_xref="InterPro:IPR013034"
FT                   /db_xref="InterPro:IPR013499"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR014727"
FT                   /db_xref="InterPro:IPR018521"
FT                   /db_xref="UniParc:UPI0000EF9EB1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K2"
FT                   /transl_table=1
FT                   /translation="MSSSEDDTPLVQANGRRISSHTDSKMRDATETNGHVDPGVSIRFG
FT                   PVQAENDVDMADADAAAVPKRKSRSSVGQRKSYAEPESSEEDDQPLSKRRRTSVKHEDP
FT                   ETDDDVPLALNGRKLPKASETAIGEESDSDVPIERKLASQKKKIQQKAEKDAKVTRKPA
FT                   PPKTTKTAATKRQTNGVKKEPEDVKPSTVKKTAKPTKASDKAALSSQVKRAASSAKSTP
FT                   VKKEESEEAEDADEEEYRWWEDPTKGDGTIKWTTLEHNGVVFPPPYEPLPKNVKMKYDG
FT                   IPVTLHPDAEEVAGFFGGMLNATQHVENPTFQKNFFMDFRDILKKTGGAKDPKGNKVDI
FT                   KDFHKCDFQPIFAYYDNQRQEKKALPPAEKKRLKAEKDAQEAPYMFCMWDGRKQKVGNF
FT                   RVEPPALFRGRGEHPKTGRVKSRVQPEQITINIGKDAPVPPPPEGHKWKEVKHDQEGTW
FT                   LAMWQENINGNYKYVMLAANSDVKGQSDYKKFEKARELKHHIGRIRKDYQKNLKHELMV
FT                   ERQKATAVYLIDQFALRAGNEKGEDEAETVGCCSLKYENVTLKPPNKVVFDFLGKDSIR
FT                   FYDEVEVDAQVFKNLKIFKKAPKKEGDEIFDRLTTSALNKHLSAYMQGLTAKVFRTYNA
FT                   SHTMSTLLKDMKATGNIAEKVKAYNDANRKVAILCNHKRTVAASHANQMEKMSERIKGL
FT                   RYQRWRLKQQMLDLEPSLKKKKGAKYFEMDEDMDLEWVKEHQAFLVEEQRQKIQKKFEK
FT                   DNEKLAAEGEKEMKATELESRLQVAKDLEKKFNKENKTGKVEAEGKAPTVDKIEAAITK
FT                   LEQRIETMELQAQDKEENKEVALGTSKINYIDPRLTVVFSKKFDVPIEKFFSKSLREKF
FT                   EWAIKSVDEDWEF"
FT   CDS_pept        join(complement(1104152..1104203),
FT                   complement(1103916..1104077),complement(1102904..1103814))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111329"
FT                   /orf_name="An01g04650"
FT                   /product="Similarities to UDPglucose 4-epimerase galE from
FT                   Neisseria gonorrhoeae"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAK37000.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG323870"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9EB2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K3"
FT                   /transl_table=1
FT                   /translation="MADEQSKKPAVLIVGGLGFIGRHLALYLHENNLASEVRLVDKVLP
FT                   QLAWLAPEFQEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGETRHSQPDDV
FT                   YEVRSYALTVALGREVARRGIRSFVECSTAHVYKGGSSPRKEDDKLQPWHKLAKWKMKA
FT                   SEELQKIPGLNYCLLRLPHVYGEYDSGYFAMGICLARVHLELEKDLELLYTKDLKINTV
FT                   YVRDAASALWKAAEWRASAPTDGSAPLAFNVVDHGNTRQEDIAQALSEVFKLKCDFLGS
FT                   LASQFAKLNLDDVVDDMNEECLQGWADLLEEKKIERPGPIGPFLEKDVLKDQDMCLDGT
FT                   LFETTTGWKPSRERFNADAVRDMVDSYKRMGWWP"
FT   CDS_pept        join(complement(1108412..1108770),
FT                   complement(1108030..1108105),complement(1107129..1107956))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111330"
FT                   /orf_name="An01g04660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37001.1"
FT                   /db_xref="UniParc:UPI0000EF9EB3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K4"
FT                   /transl_table=1
FT                   /translation="MSSPSSPACSSSGAETMKELLDRGEVKASWRDKQFVHFLDLKEEY
FT                   GREFLNLVKEHVEPNRFEWTDILTSENERRACAKDFVAQYGLKYWGTPANRKKYLQEES
FT                   LADEKTLCTYPAQSEEIVRTIEILLLRKAKGYSRLSQEKAKSTQLTKSPFEAGNTSKRK
FT                   STLKETDEDTDKPVYKTRTRSTPSAIRPFKTIVCESEPEAEFQSSAAKKTKKQRTSLAR
FT                   CYTGTPEVQLPPSRGKDGMSAPHQGTFVHRAASQYAKNTKFPATEGSQSVIAAAQYAQD
FT                   TKLLATENNHIGTTASQYFKDTKFLVTASNQVGMAPVWLPFTDFDQATEFLEHMAKQCN
FT                   VMEWSPSEQLKWESMPPQVIAASVRFDWSDFEIRVRRERNEDLLLMLQELSNAWQAEDE
FT                   GKEGASGSVYKIKVMLHIGIC"
FT   CDS_pept        join(complement(1110908..1111010),
FT                   complement(1110729..1110829),complement(1110524..1110651),
FT                   complement(1109548..1110472))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19807195"
FT                   /orf_name="An01g04670"
FT                   /product="Similarity: proline-rich regions lead to a
FT                   variety of unspecific similarities "
FT                   /protein_id="CAK37002.1"
FT                   /db_xref="HOGENOM:HBG329965"
FT                   /db_xref="InterPro:IPR006745"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="UniParc:UPI0000EF9EB4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K5"
FT                   /transl_table=1
FT                   /translation="MASNIPASLRSADIGRYALRAAQLERAKPVVAYWCNFWIVNQIIG
FT                   RGLHTSDDDVKQYTTDLVDKLEQFKSENVDNDAVTDAVAANAYVEQFGLEVLGRAEATM
FT                   KANKVTKQTADTFQAAATFLELCQIWTNPPEPEIAAKIKFCKYHAVRIIKAIKAGEDPN
FT                   ASNPAPTEEDELESELRGMEAKQDDPEVQAIVGSSAAPPGQPSVEEVPDESTQPSQSPL
FT                   SLPQPPTTFADAPAAHYGADPMSTSNMEDDAETGAPLNLPSAPETFTSPAPSVPNLPDT
FT                   PADIGAKPPQARADSFHSFPPPSSIPPSSPSAASHDASSFYTRPTSGVAPPPPFVQSSS
FT                   ATAPVVSRPTPQSIPSSTPPPPAPAASSSSGVNAQSLDDQAIALAQKHARWAVSALTFD
FT                   DVNTAIKELKNSLRYLGAE"
FT   CDS_pept        join(complement(1114137..1114187),
FT                   complement(1113684..1114057),complement(1113381..1113612),
FT                   complement(1111408..1113324))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19807196"
FT                   /orf_name="An01g04680"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK37003.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG329966"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="UniParc:UPI0000EF9EB5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K6"
FT                   /transl_table=1
FT                   /translation="MSRPNAASKKFLVNQALKAERDASSALTQGQALESAIDAAENYMK
FT                   ALSLTTESKDRQALDAKCKEWLTRAERIKQDKDWQAVLQIHEKSGLTARFPKSTRKLTT
FT                   REEIILLESAKLNGFIFPPWENAPGPEDFEKGDEGLFTDKPDLHLSKLQRRILAGWERP
FT                   FDLLSKHANGIDGLKSKMPVMSVSGPTDLVQDMLTDCSVVASLCAATSRSERGLDKHHL
FT                   PIVFPCEYGQVNPRISPSGKYIFRFYFNGCFRKVVIDDRLPASKTSRSLHVVDRNHPNF
FT                   LWPAFVEKAYLKLRGGYDFPGSNSGTDLWVLTGWIPEQVFLHQDDVTAEQLWRRLFKRF
FT                   RNGDVLLTIGTGKLTEREQKELGFASEHDYAILDMREQRDRRQMLVKNPWAGDDAITGD
FT                   IADSFALGHTSHTPASSLPRTYWMDCESVLQNFENLYLNWNPGIFRYREDIHFAWDLST
FT                   ARGVAGCFAKNPQFAVTSEVGGKVWLLLGKHFRSIHHDEQTQVPQDDLEPGFISIYVFN
FT                   ANGKRVALSEGALHRGPYVDSPNTLMRLEMPPGTTYTVVVSEQSLPAVSQNFTLSALSD
FT                   NPLLLAPAQNRYACLTKTQGLWMPSTAGGNAESARYPFNPQFRLEVHDDTDISILLEPS
FT                   EPELATHVKLFWSNGERVTRVRNRDIITDSGDYRRGGSLAEKKRLGEGVYTLVCSTFAP
FT                   DQLGRFTLWISSALPCVVKPLAPEAAGRRAVISDIGILTPGKDRMLASLETKRLTRIKL
FT                   IGRSRLSTIGNRAVGPSPMLMTVELGQGPYKEILATSEDGNHSDAISGVRIEDFDLHPG
FT                   LADQGGAWIVIERIGGPGGQVEDHFEVEALAEERVDIGEWIVEDA"
FT   CDS_pept        join(1115049..1115149,1115222..1115766,1115822..1116059,
FT                   1116110..1116233)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000212132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878878"
FT                   /orf_name="An01g04690"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAK37004.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG329967"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000EF9EB6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K7"
FT                   /transl_table=1
FT                   /translation="MAGQSKPALSPWGSAVAGATGAVLANALVYPLDLVKTKLQVQVKT
FT                   NDAKDENSETVHYKSTLDAITKIVEKEGVEGLYSGIVGSLIGVASTNFAYFYWYTVVRA
FT                   FYMASNKVPKPPGTAIELSLGAVAGAVAQIFTIPVAVITTRQQTQAKNERKGLIETGKE
FT                   IVDSEDGWTGLWRGLKASLILVVNPAITYGAYQRLKDIIFPGKNSLKPWEAFLLGALSK
FT                   ALATIATQPLIVAKVGLQSRPPPSREGKPFKTFGEVMRYIVQNEGLLSLFKGIGPQIMK
FT                   GLLVQGLLMMTKERVELIFVLLFAYLRKIREQKLKKLADSAASTAKTSLPATLK"
FT   sig_peptide     1115049..1115129
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K7 "
FT   mat_peptide     join(1115130..1115149,1115222..1115766,1115822..1116059,
FT                   1116110..1116230)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K7 "
FT   CDS_pept        join(1116780..1117157,1117245..1117694)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654550"
FT                   /orf_name="An01g04700"
FT                   /product="Similarity to thermostable nuclease Tnase nuch -
FT                   Staphylococcus hyicus"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAK37005.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG329968"
FT                   /db_xref="InterPro:IPR006021"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniParc:UPI0000EF9EB7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K8"
FT                   /transl_table=1
FT                   /translation="MRWPPWASNTQASNNDHPTTTNNNDPKNLLDWSAFTELRTLIPTL
FT                   VLTTGILSAFTLHRNYLRRFPTAVNITPAYYRRRSILGKVTSVGDGDNFRIYHTPGGRL
FT                   AGWGWVPWKKVPTTRKELRDQTIHVRIAGVDAPEQAHFGRPAQPFGKEAHEWLTGYLIN
FT                   RRVRIYVHRQDQYQRVVATVFVRRALDFPVPFRRRDVGYEMLRKGLATVYEAKVGAEFG
FT                   GEVMEKKYRSAEWWAKARGLGLWKGFKKNRDAWESPREFKTRTGMEDVGDGKK"
FT   CDS_pept        join(complement(1118788..1118959),
FT                   complement(1118175..1118707))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000238772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960442"
FT                   /orf_name="An01g04710"
FT                   /product="Catalytic activity: ATP + AMP  "
FT                   /EC_number="2.7.4.3"
FT                   /function="ATP binding"
FT                   /function="adenylate kinase activity"
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAK37006.1"
FT                   /db_xref="GO:0004017"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="HOGENOM:HBG630208"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="UniParc:UPI0000EF9EB8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K9"
FT                   /transl_table=1
FT                   /translation="MTATIRQLRKAARIILIGAPGVGKGTQTERLLTRYPELASISSGD
FT                   LLRENVRRKTPLGLQAEATMQSGNLVPDSMILDLISSEFKSRGWLSSAPTSSILPSASF
FT                   ILDGFPRTATQASSLETIVPVNFVVHLVTPPSVILSRIASRWVHEPSGRVYNTDFNAPK
FT                   VPGKDDVTGEPLTQREDDSIDTWKQRLHKFEETSKALLEHYQRKGCLWRVEGDTSDEIS
FT                   PKLFAEIERQFC"
FT   CDS_pept        join(1120003..1120192,1120245..1120795,1120847..1121608)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111331"
FT                   /orf_name="An01g04720"
FT                   /product="Complex: eukaryotic DNA primase is a heterodimer
FT                   of a large subunit"
FT                   /EC_number="2.7.7.-"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="CAK37007.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="HOGENOM:HBG617734"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniParc:UPI0000EF9EB9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L0"
FT                   /transl_table=1
FT                   /translation="MIRQDFRRIDPKRRATLDHKKKQFATPVFKQQDYPHRLNFYEVPP
FT                   TDEITLEQFEQWAIDRLKVLAEIEACSYRNKSPAETEAHITPHLQKYLPLSSNTSSSNG
FT                   AADQRLKNERQKDHYSHFILRLAFSATEELRRRFVRAETMLFRFRFQRDDTRERRAFIE
FT                   SLNLDWEPVDDEEKQRLAEQLLAASPGLRRIDDETWYKVDWEKVPELVERRAVFLSKGK
FT                   AYVPGREQLSMIIAEFTARLERALELTSRALPRLDEDDRLTPILNHLSKNFGSAESVYT
FT                   ENEGFVDGAPITANNIDRLSQHFPLCMRSLHMNLRKNNHLKHYGRLQYTLFLKGIGLSL
FT                   EECIVFWRQGFKGLTDDEFNSRYKYNIRHAYGDVGGDQNRRGRGYPPYSCQKILGDSNP
FT                   GVGQTHGCPYRHFSVDNLIGLLQSTGVNDRDVLRGVREDVEKMRFHIACNRVFEHTHKA
FT                   DIKRVKEDGTWNQTDLDTIVHPNTYFKRSYLLKQMGKAPKNA"
FT   ncRNA           complement(1121866..1122043)
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="snR32"
FT                   /db_xref="Rfam:RF01247"
FT   CDS_pept        join(1122380..1122472,1122529..1122659,1122724..1123018,
FT                   1123084..1123554,1123611..1124708,1124763..1124956,
FT                   1125014..1125038)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960443"
FT                   /gene_name="sec23"
FT                   /orf_name="An01g04730"
FT                   /product="Protein transport protein sec23 "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAK37008.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG520631"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0000EF9EBA"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8L1"
FT                   /transl_table=1
FT                   /translation="MDYEALKDQWSDVEDRDGIRLSWNTFPSSRMEASRLVVPIGAVYT
FT                   PLKEKPDSPLLQYEPVTCKAPCRAVLNPYANVDVRARIWICPFCLMRNPLPPHYKDITE
FT                   STIPPELHPMSTTIEYQLARPAPAPPIFVYVVDTCQDDDSLKALKDSLIMSLSLLPVNA
FT                   LVGLITYGTMAQVHELGYTECAKSYVFRGSKEYAAKQVQEMLGLASGLRPNMPQQPARP
FT                   PLGPAARFLLPVQQAEFQITNVLEQLQRDPWPVANDKRPLRCTGVALSVAVGLLETSFQ
FT                   NAGGRIMVFTSGPATEGPGHVVGPELKEPIRSHHDIDRDNIKYYKKAVKFYDNMAKRAA
FT                   NNGHIVDVFAGCLDQVGMLEMKNLANYTGGHILLTDSFTSSQFKQSFVRIFDKDAKDNL
FT                   LMGFNASLEVLTTKELKVTGLIGHAVSLNKKSSSVGETECGIGNTCAWKMCGIDPASSY
FT                   GVYFEIANQGGPAAVQPGPQRGMMQFLTYYQHSSGHYHLRVTTVARPLSGPAGDPTLAQ
FT                   SFDQEAAAVLMARIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYRKDDPTSFRLEKNF
FT                   TLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDVGDSLVMIQPTLDSYSLEHEGS
FT                   QPVLLDSASIQPAHILLLDTFFHILIFHGETIAEWRKAGYQDQEGYENLKVLLEQPKED
FT                   ARELISDRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGGYGGGVTSQIIFTDDVSLQ
FT                   TFMDHLMKLAVSGTS"
FT   CDS_pept        join(1125481..1125484,1125545..1125578,1125645..1125765,
FT                   1125832..1126156,1126212..1126225)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878879"
FT                   /orf_name="An01g04740"
FT                   /product="Remark: the ORF overlaps with A. niger EST
FT                   an_2410 in EMBLEST"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK37009.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG594170"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniParc:UPI0000EF9EBB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L2"
FT                   /transl_table=1
FT                   /translation="MPPKFDPNEVKIIHLRVTGGEVGAQSALAPKIGPLGLSPKKIGED
FT                   IAKNTGDWKGLRVTVRLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIKHSKSI
FT                   PLDEIIEIARKMRHRSLAKELKGTVLEILGTAFSVGCQVDGRSPKDVSDDVKAGEIDIP
FT                   SE"
FT   CDS_pept        join(complement(1128697..1128869),
FT                   complement(1128589..1128655))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654551"
FT                   /orf_name="An01g04750"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37010.1"
FT                   /db_xref="UniParc:UPI0000EF9ED9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L3"
FT                   /transl_table=1
FT                   /translation="MRIHRREAETSGHKPKASIILQPWRHPEAEKKIPTKTHAASDQVE
FT                   KMAESLPLDKYLRARCRYKRDDCQWDSDRLPSLL"
FT   CDS_pept        join(1131918..1133686,1133736..1135087,1135460..1136349,
FT                   1136402..1137031)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212155" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878880"
FT                   /orf_name="An01g04760"
FT                   /function="binding"
FT                   /protein_id="CAK37011.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG329970"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000EF9EDA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L4"
FT                   /transl_table=1
FT                   /translation="MLPSVAPFPPVQPHHLSYRHGADATNGPYDRNTSFLTSLPRSDFG
FT                   KDSFQSVARSRLQYPHPIQRLEVPDATGLVPSPKSAGEHALRRKTPNGTLAAGYDGTPG
FT                   DTTIQPASKHLLVSPIDSGHLIPPHTGFPVETWQQANLDQSSAGKHMNFPPVYRNDSSR
FT                   TNAGPAELTQGMNGTSWVRSLNYVPGMDSMLNQSLPMQPSQQRFYWHNGAYVPTVLPAT
FT                   LQPCVGPTASAGTGPYGPYWPDGVYIPYRPAAFRDARFDSPTPFAKATNPPALQLFDAG
FT                   QQPFSRGALSSGSHPDPGLAWNQAPAGMVNSELSMKNNFPRRHSEQKVAGLPGGQRTLP
FT                   YHTRQSNPTPGFSHQQVHDTGPSWSGPPNTQGVQLGSTASPQATNVEFKEKVLTWAHGV
FT                   YVDLLASIHQARRNSISTAAAEGQSQRFLKPSIYPKPPRQPGLDFSNTNTLESTRHNNY
FT                   SSGQHDLVQRNNTIGNIGHNDTASFQAGRRYERASLSQFPQAATDVQMLDRLRHTGRFT
FT                   ASTATSRFGAAPLNEGSITANAVSSLEMLSHLCAESGWEWIDGMLLGGCLAYGLGDYHK
FT                   AMRWYTRIIARDATHVEAISNLAATLLALDRRDEALQHWLRAVKLRPSFFEAVEHLIGL
FT                   LCSSQRGKEAVNIIEFVQNSIRSPKNGDCFASDEHASEPESDAESRASSASDLGSYEKA
FT                   SFDYDDDFGRSVATNRGSADVGSAGFGSSGYAIPGCDNGRMLALVHAKGNMLYALGDNA
FT                   AAAVAFEDAILIAAGRRRHGIQSLIKQIFSAFMQGTHHGYPGPEQREQQETILLYPDHA
FT                   LQTAKLVFAPCGTPPGIKYVPEGLARKAAISTTSNSLLSLAKIYQDGMSNISSSGVPRS
FT                   APGVRDILALYYLSLSLQPSPSTANNVGILLAGIQNNAPKKVLPRPSGEMQHPEIPGVI
FT                   PGTGISLALAYYNYGLHLDSRHAHLYTNLGSLLKDIGQLQAAIRMYEQAVHCDSNFDIA
FT                   LANLANAVKDAGRVNDAIVYYKRAVKVNPEFAEAVCGLANALNSVCNWVGREYPLTKYR
FT                   RPQLPSGLTAPNAPTVLPFHTFTCPLSAKQIRQISQRNGLRISCSTLRSPWLPATVFPP
FT                   PPPPHPYIKVGYVSSDFNNHPLAHLMQSVFGLHNPSRVKAYCYATTVSDKSIHRQQIEK
FT                   EAPVFHDASGWPVDRLVRQIVEDGIHILINLNGYTRGARNEVFAARPAPIHMSFMGFAG
FT                   TLGAEWCDYILADELSIPPETLSPGRRNIRMEDRLLEEDHGEDLENWVYGEKIVYTRDT
FT                   FFCCDHRQSAPDAQDPRLAWDQEQARRWRMRKELFPNLSDDTIILGNFNQLYKIEPTTF
FT                   RTWLRILARIPNAVLWLLRFPDLGEQNLRETAVAWAGEETASRIIFTDVAPKNTHISRA
FT                   KILDLFLDTPECNAHTTATDVLWSGTPLLTLPRYKYKMCSRMASSILSSALPKSDAGRE
FT                   AQSDLIAMSDEDYENKAIRLCLSLKYQPGGQGHATGRLADLRRMLFEERWSSRLFDTKR
FT                   WVRDLEDAYERVWQRWVNGEEGDIWL"
FT   CDS_pept        complement(1137725..1139395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878881"
FT                   /orf_name="An01g04770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37012.1"
FT                   /db_xref="UniParc:UPI0000EF9EDB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L5"
FT                   /transl_table=1
FT                   /translation="MAEQFNKLVDTIGGLSLADRSTSHCSNPTQTLVKTIWELVKSCQS
FT                   TSANAAHVGTVIEGTQTPSGQDIARLSSLRKEAVALEQITKNLSDATENYIIAYIISLA
FT                   GPWTLEQKMLLHFSDEVRRIIRNVLDDANTDDCSVVRKILENCYDQSLRASGTLHPAEY
FT                   FDSLEEASLEEPYDPDFESEEYYEHENRLAIDDSYAETLRVQCERRAEREQQQREEWIG
FT                   FWVRALGQCPDEPTTLFYSPANSLLNSHLAEVPRYLFRAFDDASSGWSDNHIVASAESR
FT                   AAISERSRTDLLSRSRGEITRMLYSHLKKSLFGAEDTDNLMSWSSSLMFVIQYAIWRCN
FT                   KRRCDPSEVKICMVDTRKFPRGQFARDKSLLRAYRDAPELDENRRRFFDFRLEDPYYDN
FT                   GEYLSQGVLHHAGRSSVVSLEQLIHAGLYDLYPEFRDPASRNLWTNRVGSLRLAWSNEH
FT                   TTTQLDIRSAVKVARECFNNYFNALDIALVLLSFKERKLRTPATKAPQQQRNSHDFGPV
FT                   EVQRYTTIIEDMMAKARGIPIALRGFTADSQLEEIFECS"
FT   tRNA            1139912..1139985
FT                   /gene_name="tRNA-Val (CAC)"
FT   CDS_pept        join(complement(1141306..1141370),
FT                   complement(1141139..1141210),complement(1140978..1141022),
FT                   complement(1140722..1140884),complement(1140528..1140614),
FT                   complement(1140291..1140356))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19807197"
FT                   /orf_name="An01g04790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37013.1"
FT                   /db_xref="UniParc:UPI0000EF9EDC"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L6"
FT                   /transl_table=1
FT                   /translation="MEYLLHRICPASFPGLVAFTTNRAKYASGVDHTAPNETIDGKRMA
FT                   HGLASSNATKKCSKDSPSQSVSVIFNRSSICELGMYLLRSYTDVSQLDRCRLLPYYLST
FT                   QLQALVRNQYAPSSTYLNETPNTFAVSLALDIIRQAPLAENETEGYCDHSMVMSNRLIW
FT                   VV"
FT   CDS_pept        join(1141966..1142081,1142244..1142435,1142514..1142721)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878882"
FT                   /orf_name="An01g04800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37014.1"
FT                   /db_xref="UniParc:UPI0000EF9EDD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L7"
FT                   /transl_table=1
FT                   /translation="MSCSRSFNKSCENMGSCYNAFNNQGSLGPEACTWGFSLWLVCWTT
FT                   CLPLYLTNFLRCQSWIVVDVPSTEPRYCVCGACRTEGEWAVSTHVQDQLPWEMDNRVDA
FT                   DWLFDGYVDEDGAFLVCSPHKTPSLAYAEYKKWIMIFLQTRFCRARVERPRELVRLVVA
FT                   ELAARKYW"
FT   CDS_pept        join(1143914..1144048,1144162..1144314,1144735..1144786,
FT                   1144873..1144964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878883"
FT                   /orf_name="An01g04810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37015.1"
FT                   /db_xref="UniParc:UPI0000EF9EDE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L8"
FT                   /transl_table=1
FT                   /translation="MDSIVWDKNPVASHAASNGEFQIRMPCCKGAVYNPRAGIVTTVEP
FT                   VIPTSLASGGMGDGERGWDGCVARDRGPFLLAFGVYHRWLVGLSVKQAGRDDPGSSSFL
FT                   LRSLATICRSWIVRPLDSDNLVGQLSSVLSVAPHAANIS"
FT   CDS_pept        join(1146084..1146163,1146248..1146355,1146470..1146570,
FT                   1146991..1147190,1147272..1147322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960444"
FT                   /orf_name="An01g04820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37016.1"
FT                   /db_xref="UniParc:UPI0000EF9EDF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L9"
FT                   /transl_table=1
FT                   /translation="MVDGAELSYFAPLSPPRPIRIYAHTNAPSPRGLAGTPYVEGVCAL
FT                   GAVPGRIAYLVGGPPPPFIPGGTHPVDKYLSMVSESWCALAESQSHSNWESGGYPNPNL
FT                   AKSIIDHPLTSHTEILRHPIMWWESAQISTSRLCCANLVLLVASGSTLFQGGGVAAFSL
FT                   VGGVVVVVMTLPYYWG"
FT   CDS_pept        complement(1154364..1155293)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654552"
FT                   /orf_name="An01g04830"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK37017.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG329977"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI0000EF9EE0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M0"
FT                   /transl_table=1
FT                   /translation="MAPTHRRGPWVPEEDQLLLQLVREQGPNNWVRISQHMHYRSPKQC
FT                   RERFHQNLKPSLNREPISAEEGLMIERMVNEMGKRWAEIARRLGNRSDNAVKNWWNGSM
FT                   NRKRRGLPTSSSPHAGRTMHGRVEAPYARASLSMSSPISRSRYSSISNDRPLTSWTKSP
FT                   SSRRDSFSAASIDCPRQLTPIYTLPALNRPVETPLTSPAFSEASSMEPPSMISDHNSVS
FT                   SSSPRTIASPQLLPLPVDMRQQYGDFRRQSTSDDIYAYHDLSLKQRWISDHQQWNQHSP
FT                   LSPTWSAPIEDKTEAPRDSRMGLQNLLN"
FT   gap             1156638..1156737
FT                   /estimated_length="unknown"
FT   CDS_pept        join(complement(1158051..1158131),
FT                   complement(1157575..1157888),complement(1157037..1157262))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878884"
FT                   /orf_name="An01g04840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37018.1"
FT                   /db_xref="UniParc:UPI0000EF9EE1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M1"
FT                   /transl_table=1
FT                   /translation="MNRGDGTAVPCLWCRGIQIEWASEHLCPVAPARRYSGPDSRLRMI
FT                   PMSIPTLPGMRQSQKIPNLQRALAGSAPITAPTQTVHVLGNGPRGVEEGSSLRPVRMRV
FT                   SGGQWALPAKGEAKSSRVTNRSIGVLTTRRGGGGGAGACPRSRYTLTPLCNHSEVLFVI
FT                   FPHLSQIGNLLPCPLLSLSLFFSFFLPFLPSIRISNSEVARPA"
FT   CDS_pept        join(1158507..1158636,1158818..1159055,1159108..1159197,
FT                   1159297..1159360)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111332"
FT                   /orf_name="An01g04850"
FT                   /product="Similarity to hypothetical protein BAB09566.1 -
FT                   Arabidopsis thaliana"
FT                   /protein_id="CAK37019.1"
FT                   /db_xref="UniParc:UPI0000EF9EE2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M2"
FT                   /transl_table=1
FT                   /translation="MQQKYDRSHGILRFPLFGIAHQCGRVAFCLFIGCSPGAWPSQPAI
FT                   QSKVLVSSPRRYRPAVILSGGNGWGQLEKLKLTILDYGITSTIRLPSIHQNLALGAICS
FT                   IGYNVAAIGRSRLITLCSIGVGTGKGGNNKLRQMFKTIGSRSSCSHLCRSPPPSIGVSE
FT                   KIFQASIFPA"
FT   CDS_pept        join(1159801..1159814,1159912..1159967,1160042..1160151,
FT                   1160232..1160248,1160520..1160601,1160695..1160746,
FT                   1160781..1160809,1160952..1161053,1161272..1161361,
FT                   1161444..1161467)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19807198"
FT                   /orf_name="An01g04860"
FT                   /product="Similarity"
FT                   /protein_id="CAK37020.1"
FT                   /db_xref="UniParc:UPI0000EF9EE3"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M3"
FT                   /transl_table=1
FT                   /translation="MLPVNLVTEVSVTNWFLNPPKQATDWSAKIRYLSFWKRGASPIQG
FT                   MMIGDLGGRGKRAISVRSGEIYYTQPFTSITFQVPEPHPIPSMSTSVNPWSHMKYKNPS
FT                   TAIELLQVVLSGVKRHSYIALLTQLFYSVTTSKLTPPLFLMYFKRLESTYVNNYNNNNK
FT                   RIYSTSIATTTYYRPGWTEAKCYDQHTT"
FT   CDS_pept        join(complement(1166109..1166243),
FT                   complement(1165952..1166026),complement(1165649..1165850),
FT                   complement(1165171..1165565),complement(1164901..1165022),
FT                   complement(1164700..1164789),complement(1164557..1164589),
FT                   complement(1164357..1164431),complement(1164172..1164277),
FT                   complement(1163891..1164106),complement(1163379..1163492),
FT                   complement(1163280..1163339),complement(1162942..1163235))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654553"
FT                   /orf_name="An01g04870"
FT                   /product="Similarity"
FT                   /protein_id="CAK37021.1"
FT                   /db_xref="UniParc:UPI0000EF9EE4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M4"
FT                   /transl_table=1
FT                   /translation="MVYFVSFFLLHFQPRQGRKARKSHGWMLRRLNLMAKAWPLSKTRQ
FT                   GLHEDVASSPKRSHKIESSLATWPKAETGKTQEFVQTEQSLCVLPIRFLLPFQPRRQLA
FT                   VSPLDIRTGSIGPQKKYQCHKWKSVQRAMTAASIFLATVAPEELTQSGQCSAYHGSWWA
FT                   PSHRLLSSHSPYLFLSVPSGRYTPEVFPDGSIGEPGADRQRGGGLPKEELRVVEMASDG
FT                   VVRYGAVRRRRLGKCTVVKVIVARLVQKNLPFQTLFSFISFSLVGLSQAIDPSDPIASG
FT                   ATNQPIRHSLVPVSDPDVPRIGLRATRKWEAAAAPGHAASSWVLFLGWMRTTAHPRLQW
FT                   PTDVPATRYSRCTLIRWHRSRINFFDSGSAVENEACYQLIRNAGNGIKKVWVVEKESFS
FT                   LDLSDLKEDSKLESTTTTTTTIPRHGIKASAALERVHCSSAMVVVSVTGRVNTTYPTSR
FT                   MRDGAFQICGRGSTRKVQVTLAEHIGGTEGILRCSHYRGIIASIPLKGFASAKTKRGED
FT                   GNFVIPSNGYWIDTVNPYISYRAEDGAQQLLCHTKPKEIIGAMPSRASGKDRGTHMVPE
FT                   GEDINPDQRGHPITGFPANSCCVLYVPFNTFTTPSPLPSSQISTSIRYRATSWVSNHLL
FT                   HTS"
FT   CDS_pept        join(complement(1167731..1168613),
FT                   complement(1166572..1167656))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654554"
FT                   /orf_name="An01g04880"
FT                   /product="Complex: B. thermoamyloliquefaciens alpha-
FT                   glucosidase II is a homohexamer"
FT                   /EC_number="3.2.1.20"
FT                   /function="carbohydrate binding"
FT                   /function="maltose alpha-glucosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAK37022.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0032450"
FT                   /db_xref="HOGENOM:HBG329982"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000EF9EE5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M5"
FT                   /transl_table=1
FT                   /translation="MLYAEDNKLIFRFDDHLLWIQPWGENALRVRATKLASMPTEDWAL
FT                   SSKVTSIEPTISIEEHKDSSITNGKIKATVSQRGKITIYNQKGEKLLEEYARNRRDLKD
FT                   PKCSALEVEARELRPILGGDFHLTMRFESLDPKEKIYGMGQYQQPFLNLKGVDIELAHR
FT                   NSQASVPFALSSLGYGFLWNNPAIGRAVLGTNTMSFEAYSTKVLDYWVVAGDSPAEIEE
FT                   AYSKVTGYVPMMPEYGLGFWQCKLRYWNQEQLLDVAREYKRRNIPLDLIVVDFFHWKHQ
FT                   GEWSFDPEFWPDPDAMIKELQSLNVELMVSVWPTVENASTNYPEMLEKGLLIRHDRGLR
FT                   VSMQCNGDITHFDATNPSARAYVWSKAKQNYYDKGIKVFWLDEAEPEYSVYDFDLYRYH
FT                   AGSNLQIGNIFPKEYARGFYEGMESAGQTNIVNLLRCAWAGSQKYGALVWSGDIASSWS
FT                   SFRNQLAAGLNMGLAGIPWWTTDIGGFHGGDPSDPAFRELFTRWFQWGAFCPVMRLHGD
FT                   REPKPENRPTDSGSDNEIWSYGEEVYEICKKYIGIREELRDYTRGLMKEAHEKGTPVMR
FT                   TLFYEFPADKKAWDVETEHLFGSKYLVVPVFEAGKRSVEVYLPAGASWKVWGQEDVIHE
FT                   GGKEIQVDCPIETMPVFVRV"
FT   CDS_pept        join(complement(1170337..1170446),
FT                   complement(1170038..1170126),complement(1169887..1169983),
FT                   complement(1169584..1169756),complement(1169457..1169529),
FT                   complement(1169065..1169144),complement(1168854..1168924))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878885"
FT                   /orf_name="An01g04890"
FT                   /product="Similarity"
FT                   /protein_id="CAK37023.1"
FT                   /db_xref="UniParc:UPI0000EF9EE6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M6"
FT                   /transl_table=1
FT                   /translation="MTLDDSQCDNDDLHVKQHMAKAVIELLVTSGISVTREKSCGGNQV
FT                   DSVSLEALQSAHITSCYRLTYEVEPMLPAISSLCPSQRYDVTERPAQESSAPRRKPRTT
FT                   LADGYQTVPQLPGHFLVLIHRLANGEARLKPGVTPTGAPGDAIFDHMRAIASNSDGVHT
FT                   PDQRSAPSLRSMMGNLTGPVFPPSPLLVISTLPRNFTSSFKECGDEAGQQHARRGVGNT
FT                   VTQAAMRP"
FT   CDS_pept        join(1170822..1170965,1171038..1172321)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212188" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654555"
FT                   /orf_name="An01g04900"
FT                   /product="Similarity to hypothetical protein CAC18296.1 -
FT                   Neurospora crassa"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAK37024.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG329984"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR019416"
FT                   /db_xref="UniParc:UPI0000EF9EE7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M7"
FT                   /transl_table=1
FT                   /translation="MEVASAQQPSLQLDASNAAPVADTMDASMDIDMDIDLGPLPEAEP
FT                   IETEQTLVATTAVQDGSIDPLNEEAQYEKVHIRGVDELTTDNIKQFAVEHFALEEPSRV
FT                   EWIDDTSANILYSSPEVGLQALSAFTQVSEEEDASALPALRLRSAKLLSTHPDSVLQVR
FT                   SAVKADRKKPRAHEASRFYLMHPEHDPRERLRREFADRRRSGGGDVSDGDYRRRRFDGR
FT                   ELQRRRDRDAGESFSANMYDDTVPASRDRSSDRSRERRGRRGGRDLFPQEEGRLSGRLR
FT                   NRSASPGRDTLMEGGYAEDDRQDRRRFRDRSPQLGRRNEGKELFPSSGAKSSDANAREL
FT                   FPNRTAKELFPQKVSNHRRSDAIDGADETADLFSRRISVPLVDGSQDQQPARRKRDIEL
FT                   FPETTETSGLNIRGAARQDQGMSIRGAANGISIKGRGASVRELFPNKYGSNAGKELFSD
FT                   KIEGRGGPRRRAEDMFS"
FT   CDS_pept        join(1172737..1172998,1173055..1174205,1174321..1174359,
FT                   1174471..1174617)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960445"
FT                   /orf_name="An01g04910"
FT                   /product="Similarity to hypothetical protein EAK99938.1 -
FT                   Candida albicans"
FT                   /protein_id="CAK37025.1"
FT                   /db_xref="HOGENOM:HBG329985"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000EF9EE8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M8"
FT                   /transl_table=1
FT                   /translation="MPPPSQNIPLASTLVARFLRTNNYTQTLKAFLQEAGLPSDAGEQS
FT                   GKDDATNWTIENLIEEKKAYDQSKNFERYGDNDKDKDVWTVPAPTKPNIIQTPSSSNLL
FT                   ACSVGQWQRPDAQAEPYLIATGADKHLHLFQTSPGHDLVQSFTGTSEAPILSYIPVQDG
FT                   KYILMTNMSGQLLLQKGAEIIDRRKDHAKYAVKVIAYEQKNNNDTADTFSTTTTIWIAT
FT                   AGWDSKIFLYRMQINDEAPTQIGDPIASIPLLSNPESILFTTHIDNPQDLILLVSRRDS
FT                   SNLYYYHVKPSAVSTTGYECPLIGKQNLAPHSNAWVAFSPSCLALSPHDPGLIAIATST
FT                   LPHMKVMIVRLLFPSAESLESGSAEQEQEPATQAAQAFAALSLQNREDAAILIQANTFA
FT                   PQTAYSTPQVVWRPDGSGVWVNGDDGVVRGLEVKTGKVVTLLKDGHEVGCKIRTLWAGW
FT                   VDGENGGEREEWLFSSIHYQPTWATTQARMEKISTELYTHMPVSSPTSSSTSPPTTLRY
FT                   ENRTSEKQMNHQPRE"
FT   CDS_pept        join(complement(1175510..1175516),
FT                   complement(1175323..1175374),complement(1174943..1175045),
FT                   complement(1174834..1174869))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960446"
FT                   /orf_name="An01g04920"
FT                   /product="Complex: S. cerevisiae L29 is part of the 60S
FT                   subunit of the ribosome"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK37026.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG627477"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniParc:UPI0000EF9EE9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8M9"
FT                   /transl_table=1
FT                   /translation="MAKSKNASQHHNSQKAHRNGIKKPKTHRYPSLKGVDPKFRRNHRH
FT                   ALHGTAKALKERKEGKREIA"
FT   CDS_pept        join(1176609..1176740,1176817..1176839,1176932..1177062,
FT                   1177173..1177261,1177326..1177415,1177471..1177503)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216023" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878886"
FT                   /orf_name="An01g04930"
FT                   /EC_number="3.6.3.14"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAK37027.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG663981"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="UniParc:UPI0000EF9EEA"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N0"
FT                   /transl_table=1
FT                   /translation="MSSLRFARSAFRARPSALRVPLQRRGYAEAVSDKIKLSLTLPHQS
FT                   IFKSTGVVQVNIPAESGEMGVLANHVPSIEQLKPGLVEIVEEGGASKKFFLSGGFAVVQ
FT                   PDSQLSINAVEGFPLEEFSIDNVRSQIAEAQKIANGSGSEQDIAEAKIELEVLESLQAV
FT                   LK"
FT   CDS_pept        1177837..1179222
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878887"
FT                   /orf_name="An01g04940"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37028.1"
FT                   /db_xref="UniParc:UPI0000EF9F05"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N1"
FT                   /transl_table=1
FT                   /translation="MPSAFTKPVAIMQEPKSSDLEYPFCEGSDNPQNSSSQLQYKHPDD
FT                   CPARPIMTRSDTHDTDAFHIFPMDVDKEHSKNPSTSEYKMMGALFNKDTANRQGLPDLS
FT                   NDSVVLENWYESTTGPCSTLDRGTPSLARPENTTLVILNEKSLSERNSRGPVEAKSAWK
FT                   PPRPPKPRFLAHLDVAGFESYENSTPCPMPASRDGPGGHKWLAPRLLQGMDNDISKRRK
FT                   PWSDPKLGPSRYLSRPAKRGAKSYLTKNDLSQPFPGPWPSIDGLLLRQDSRIAKSSPAK
FT                   ICVRDHSNALSSPQEARESNVKRIGNWLGKLLSWVSHLSKLKERGVISISLVGQRSLQH
FT                   PRFGFASYEYSVSFKWSNTSGSIAIHQGQEEINLPAASKNATRLFRADITVPYLAMRIL
FT                   MGFCAVCRSRMSRGVMISFVRLFMRLIGLPVLYFLERLSVSLSIHPRESNTTQSARDQH
FT                   AVF"
FT   CDS_pept        join(complement(1182165..1182315),
FT                   complement(1181747..1182114),complement(1179842..1181692))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212221" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960447"
FT                   /orf_name="An01g04950"
FT                   /protein_id="CAK37029.1"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="UniParc:UPI0000EF9F06"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N2"
FT                   /transl_table=1
FT                   /translation="MTADSGLSAAGSSTYASNTLHVGDGTWDSERDTYLLPNLMGINFD
FT                   TMRYNGMGNRFKDMPEYHTLIVVHGVIATIVFLFLVPISVLIIRYYSRWNPFWAFKLHV
FT                   WCQVLTLLLSTVVFVFGWFAVGPKRSLTNPHHGIGLAIYVLVIFQILWGWLVHKIERNR
FT                   RSYHVPLKLVIHRWIGRALAILGLVQIPLGLTLYGSPKVLFILYAVVAFILLAVFFVLS
FT                   YLYDTEGYHMESGGYESRLSYVSGPSAADDHGHSNLGPMAAAGATGAGLASLFRRRSRG
FT                   RPHDYDESHTSFSDEKLSDEGPRRGGKGNLLLKLGAIGGGAWLAKKFFDRRRERDNDTE
FT                   SGRYSRAHTRSDSMTEESLSRLEDGRRPEPTAHTPLNRPPSRPPSRPPSRPPSRPPSRP
FT                   LSRPQSPGSSYLYNSTYLSEAPPRRPSHGLRDALLGAGALAAIKGFFSRRKGDAEQRRV
FT                   EEMRRREMEDERLARANSKRRYPGEGYYPRRDRPASFTATDLSTDLSRPPRGPPHGESI
FT                   VSAAGPPMASGAVDGARSDIPPAPGPPVPPPAASEYPGPAASTHGPTELASGVAAGTAL
FT                   GAASSAHRRRSASRHRSSSRPRSSSRHRDPIASPPVSVKLKMHNDGRHVTLRRLTDEEA
FT                   AASREARRRERRNSRRRAGSASSLSGNEGGSYDRWRRVEELERQQQEQMQREQAAAAAA
FT                   SSGFPATSAAPSSSMPPATSAYYAPPPQNGNGSHMPPPPPPPVPSSHPYGTGSIASPGT
FT                   FTGTEASGDYASNRRRRRAERARARQERQQHGVEFT"
FT   CDS_pept        join(1182601..1182669,1182834..1182993,1183076..1183329)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878888"
FT                   /orf_name="An01g04960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37030.1"
FT                   /db_xref="UniParc:UPI0000EF9F07"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N3"
FT                   /transl_table=1
FT                   /translation="MEGGGGLGSMGNRDKRTVAGHQPPVSVYPGQPPADSAICRGRPPA
FT                   YVSMIVIDTIERTLADQGVTLFAMVDALINGRSVCCSMFAGDFQSTDPSYLINSSEAVG
FT                   LSVVLIVKLTLRSSRIDQGSSTKFRSINPPRNRSTRLARNPTPAISQQSWESGQAR"
FT   CDS_pept        join(1183493..1183533,1183608..1183625,1183718..1184156,
FT                   1184228..1184596)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878889"
FT                   /orf_name="An01g04970"
FT                   /product="Function: human CTNS is a lysosomal cystine
FT                   transporter."
FT                   /protein_id="CAK37031.1"
FT                   /db_xref="HOGENOM:HBG716305"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI0000EF9F08"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N4"
FT                   /transl_table=1
FT                   /translation="MATQLEIFVRALSRLLGWIYTFCWSASFYPQPINNFRRRSTTGLA
FT                   IDFPTINVLGFVCYTIYTSAFLYSPVIRHQYAARHPLAEDPTVRFNDFAFALHAVVLSF
FT                   ITYTQFWPFIWGFKVSRHQKVSKPVAGLFWGSIVGVTIVIFIVLGQSPNNGYDPYSWAW
FT                   IDVIYALSYVKLVITIVKYVPQAWVNYKRKSTYGWSIGQILFDLSGGVLSLAQLLLDSS
FT                   FQDDWSGVTGNPIKFLLSNVTIFFDLIFVVQHYILYRDAVDDSGKDRNPSDRTPLLSVS
FT                   DGQPGRS"
FT   sig_peptide     join(1183493..1183533,1183608..1183625,1183718..1183739)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N4 "
FT   mat_peptide     join(1183740..1184156,1184228..1184593)
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N4 "
FT   CDS_pept        join(1186471..1186577,1186665..1187622)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878890"
FT                   /orf_name="An01g04980"
FT                   /product="Function: Fusarium sp. Tri6 is involved in the
FT                   regulation of enzymes"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK37032.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000EF9F09"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N5"
FT                   /transl_table=1
FT                   /translation="MHPSPPTCDKPFKEIGFIPLRHPESPRYMNYKYRRSRVSRALLSS
FT                   SEPSAMTSRTTINRAMLMVPGGSSTHSTMSSEVQPYLFPAIAFQQAPLSDARSMSGSVP
FT                   YAFDQAQPLHQRKPDVGTHYFQDQESYTPLFSNQTIPPQSFRPDIESFPPAIPTTDGAY
FT                   FPIDQEEWLAIAVSQSPLNPTNTDYYLPESAPSSFSQSRLTPVTTASLSSATTADLDFE
FT                   LDLDLDLDDLQLQSLSDTSSARSQTRDLTNYGIKNPDGTWRCAYPGCSSHAVFRRGCDL
FT                   RKHYNRHRKHLFCRYEGCPQAVRGGFSSKKDRDRHEAKHNPEIPCEWDGCQRVFSRVDN
FT                   MKDHVRRIHKRRET"
FT   CDS_pept        complement(1189457..1190668)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212246" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960448"
FT                   /orf_name="An01g04990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37033.1"
FT                   /db_xref="HOGENOM:HBG329990"
FT                   /db_xref="UniParc:UPI0000EF9F0A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N6"
FT                   /transl_table=1
FT                   /translation="MTESYGLDEPRTPGLRPTEIDYLPKVSPPPFDTGDQSPKGGLPKH
FT                   DAEAQFPSSSRKLPEFQKPDSTEGNSVLIRHLEPNRPDIAWFETEHPLQRSTIADDFPV
FT                   LPKIIFGPEKSSVETKEPVDVVARKALNLISPSEPKEGGPSVAPKDLPVAYKEPPRRPS
FT                   IPVEEPALKEEQQQQHTPPNIPHFSHLFQDGKLPDPETRLGKLLIAPSEPAAQLPALHP
FT                   STTASAVNHNLPSLSTALAGVTDVPPPASAGRLNGSSFGPLPPVSASSPPVSRTDPVWE
FT                   HQRLGQIPPPPPQVPPSPYSHLSPASSKDMSAMSSPASQQAYWRPPIKADITYLTSTYE
FT                   TAPQTAKSPATSYPTPTDQTPASTCDRSYNPPTHPNGAVSTGTYKCRHPGCTAAPFQTQ
FT                   YLLK"
FT   CDS_pept        join(1194351..1194367,1194408..1194426,1194486..1194572,
FT                   1194645..1194905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878891"
FT                   /orf_name="An01g05000"
FT                   /protein_id="CAK37034.1"
FT                   /db_xref="UniParc:UPI0000EF9F0B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N7"
FT                   /transl_table=1
FT                   /translation="MGLRAKPGNLLKLSDRSSLLLIGQSVKPSNHPILDSFRLRPWFGL
FT                   VCVGTLVSIRALPSTVNPNGSGARLKEGPLPFPYQSGKGVSSWFEPDVVEITSRTGSKA
FT                   PSCLLLFVRLPRWNDILIHLKFG"
FT   CDS_pept        join(complement(1196195..1196248),
FT                   complement(1195939..1195981),complement(1195817..1195831),
FT                   complement(1195703..1195746),complement(1195544..1195621),
FT                   complement(1195282..1195308))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878892"
FT                   /orf_name="An01g05010"
FT                   /product="Similarity"
FT                   /protein_id="CAK37035.1"
FT                   /db_xref="UniParc:UPI0000EF9F0C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N8"
FT                   /transl_table=1
FT                   /translation="MNHDGETDDDLPSPFPYSGILVSVADLWFGWGSSLLFVMREETHS
FT                   ARVSRVEFILGSALRSHSSTLSDEGVAGLPVAKTTPQSTTQ"
FT   CDS_pept        join(complement(1197637..1197807),
FT                   complement(1197546..1197555),complement(1197336..1197446),
FT                   complement(1197068..1197158),complement(1196917..1196995))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19807199"
FT                   /orf_name="An01g05020"
FT                   /product="Similarity"
FT                   /protein_id="CAK37036.1"
FT                   /db_xref="UniParc:UPI0000EF9F0D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8N9"
FT                   /transl_table=1
FT                   /translation="MGSPHPSPTLPPLLPLQPPTSYYPNRRKVTLCMQEEKKNHTSLIH
FT                   GRRTKAERVQAPVRPAVVLQQQQQQHSHIDDDDAGWSLVSALDPFPFPPSLPSTSAVFS
FT                   VPPRLRPPRPSLIPLFPLPSGPCKTRTIPPLSNDDEDDDDDDGTAAAAL"
FT   CDS_pept        join(complement(1199532..1199577),
FT                   complement(1199270..1199406),complement(1198919..1199214),
FT                   complement(1198094..1198793))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000131666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878893"
FT                   /orf_name="An01g05030"
FT                   /product="Similarity to oxidoreductase OXRD-8 from patent
FT                   WO200071679-A2 - Homo sapiens"
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK37037.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG400850"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0000EF9F0E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P0"
FT                   /transl_table=1
FT                   /translation="MGKEFRIAEAPRSLSVSLYTAESHVVLDMAGAVRQPIDVPSLERY
FT                   LNLNVPDIKTPLDVKQFGFGQSNPTYQLTTADGSKYVLRKKPPGKLLSKTAHKVEREYK
FT                   IIHALGNTDVPVPKAYCLCEDSSVIGTPFYIMEFLDGRHFTDPAMPGVDPAERTALWQD
FT                   AVRTLAKFHRVVPQKVGLDRFGKPTGYYDRQIATFTAVAQAQAQAVDVETKEPVGELPH
FT                   FMDMVRFFDDKTTQPQDRGTLVHGDYKIDNMIFHKSEPRVIGLLDWEMATVGHPLSDFC
FT                   NLTSPFFLDGVDHKKEMFVPKVVPGLPAREDCIRWYREVSGYDPTGDIPWGDAFFSWRS
FT                   SVIMHGIKARYALRQASSARAAEYARNTEPFALEAWERVKRVRAQLGQKARL"
FT   CDS_pept        join(1199876..1200215,1200297..1200469,1200553..1200636)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000028966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960449"
FT                   /orf_name="An01g05040"
FT                   /product="Complex: dUTP pyrophosphatases are homotrimeric
FT                   enzymes."
FT                   /EC_number="3.6.1.23"
FT                   /function="dUTP diphosphatase activity"
FT                   /biological_process="dUTP metabolic process"
FT                   /protein_id="CAK37038.1"
FT                   /db_xref="GO:0004170"
FT                   /db_xref="GO:0046080"
FT                   /db_xref="HOGENOM:HBG436079"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="UniParc:UPI0000EF9F0F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P1"
FT                   /transl_table=1
FT                   /translation="MTKETTPPPPTTTTTEPTTNTTHEPPSLPASPLAKRTKPNTTEQS
FT                   TEPSTMGSTSTPLPPLQVKKLTPTGRAPTRGSAFAAGYDMYSAKETVIPAKGKALVDTG
FT                   IAIAVPEGTYGRIAPRSGLASKHFIDTGAGVIDADYRGEVKVLLFNHSDVDFEVKEGDR
FT                   VAQLVLERIYTPEVVVVEELAESVRGAGGFGSTGV"
FT   CDS_pept        join(complement(1202228..1202281),
FT                   complement(1202160..1202170),complement(1202001..1202080),
FT                   complement(1201738..1201950),complement(1201561..1201678),
FT                   complement(1200883..1201510))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000258174" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19807200"
FT                   /orf_name="An01g05050"
FT                   /EC_number="2.7.1.35"
FT                   /function="pyridoxal kinase activity"
FT                   /biological_process="pyridoxine biosynthetic process "
FT                   /protein_id="CAK37039.1"
FT                   /db_xref="GO:0008478"
FT                   /db_xref="GO:0008615"
FT                   /db_xref="HOGENOM:HBG661459"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="UniParc:UPI0000EF9F10"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8P2"
FT                   /transl_table=1
FT                   /translation="MSADLLVPETRVLAVASHVVYGYVGNKMASAVMQLMGCDVAALNT
FT                   VHFSNHTGYRQFKGTRATAEEITALYEGLTQSNLLDFDVMLSGYAPSAAAVEAVGAIGM
FT                   DLQRKAEKNPGSFFWVLDPVMGDQGRLYVNDDVVPAYKKVIRHADLILPNQFEAEVLSG
FT                   IKITSLATLAEAITALHAIYNIPHVIITSVQIASLSDSPLPNTLTVIGSTTRSDGAPRL
FT                   FRIDVPALDCYFSGTGDMFAALTVARFREAVFNADPTLRNTKSWVSPDNVPATELPLAQ
FT                   STRKVLASMHCVLEKTLEARDAELRAIVPDESEKLLSQEDQQKRAHLRESKAAEVRVVR
FT                   HAQYLREPEVEFQASEWRREDLPAQFR