(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE10

ASPNC_1.PE10         Location/Qualifiers
FT   CDS_pept        join(complement(25393..25634),complement(25197..25320),
FT                   complement(24810..25096),complement(24270..24741))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874682"
FT                   /orf_name="An01g00100"
FT                   /product="Catalytic activity: Pyruvate + lipoamide  "
FT                   /function="catalytic activity"
FT                   /protein_id="CAK36861.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI0000EF9EC1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C0"
FT                   /transl_table=1
FT                   /translation="MAAPRLFRPAARLLSSRLTSAPLRPQTACAPSILRFRGYATESGT
FT                   KEVTVRDALNEALAEELESNKKTFILGEEVAQYNGAYKVTRGLLDRFGPKRVIDTPITE
FT                   AGFCGLAVGAALAGLHPICEFMTFNFAMQAIDHVINSAAKTHYMSGGIQPCNITFRGPN
FT                   GFAAGVAAQHSQDYSAWYGSIPGLKVVAPWSSEDAKGLLKAAIRDPNPVVVLENELLYG
FT                   QAFPMSEAAQKDDFVLPIGKAKIERPGKDLTIVTLSRCVGHSLNAAAQLKQKYGVDAEV
FT                   INLRSVKPLDVETIIQSLKKTGRIMCVESGFPMFGVSSEILALSMEYGFDYLTAPAVRV
FT                   TGAEVPTPYAVGLENMSFPQEDTIVSQAAKLLRL"
     atggctgctc cccgactttt ccgcccagca gctcgtctgc tttcttcgcg ccttacttcg        60
     gctccccttc gccctcagac cgcatgcgcg ccctcaattc ttcgcttccg gggatatgct       120
     acggaatctg gaaccaagga ggtcactgtc cgtgatgctc tgaacgaggc gctcgccgag       180
     gagctggaga gcaacaagaa gactttcatt cttggagagg aggttgcgca gtacaacgga       240
     gcttacaagg taacgagggg tctgttggac cgcttcggtc ccaagcgggt tattgacacc       300
     cccatcacgg aagccggttt ctgtggtctc gccgtcggtg ctgctcttgc tggactgcac       360
     cccatttgcg agttcatgac cttcaacttc gccatgcagg ctatcgatca tgtcatcaac       420
     tctgctgcca agacccacta catgtctggt ggtatccagc cctgcaacat caccttccgt       480
     ggaccgaacg gtttcgccgc tggtgttgcc gcccagcact cccaggacta ctccgcttgg       540
     tacggcagta tccctggtct gaaggttgtc gctccctgga gctcggagga tgccaagggt       600
     ctgttgaagg ctgccattcg cgatcctaac cccgtcgttg ttcttgagaa cgagctgctg       660
     tacggtcagg ctttccctat gagcgaggcc gctcagaagg atgactttgt tcttcctatt       720
     ggcaaggcca aaattgagcg ccccggaaag gacttgacca ttgtcaccct ctcccgctgc       780
     gttggacact cgctcaacgc tgctgcccag ctcaagcaga agtacggtgt tgacgctgag       840
     gtcatcaacc ttcgttccgt caagcccctc gacgttgaga ccatcatcca gtcgctcaag       900
     aagactggtc gcatcatgtg cgtcgagtcc ggtttcccca tgttcggtgt ctcctctgag       960
     atcctcgctc tctccatgga gtacggtttc gactacctga ctgctcctgc cgtccgtgtc      1020
     actggcgccg aggtccccac cccctatgcc gttggtctcg agaacatgag cttcccccag      1080
     gaggacacca ttgtcagcca ggctgccaag ctgttgcgcc tgtaa                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page