(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE100

ASPNC_1.PE100        Location/Qualifiers
FT   CDS_pept        join(254023..254044,254113..254139,254292..254551,
FT                   254617..254736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806404"
FT                   /orf_name="An01g01090"
FT                   /product="Complex: Dr1 directly interacts with the TATA-
FT                   binding protein"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43486.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000EF9D72"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L0"
FT                   /transl_table=1
FT                   /translation="MSDREFSANDDLSLPKATVQKIITEILPPSSGQTFSKDARDLLME
FT                   CCVEFITLISSEANDISEKEAKKTIACEHVERALRDLGFSDYIPDVLAVAEEHKEQLKS
FT                   REKKQSKMEQSGLSEEELLRQQQELFRSATEKYHAAPE"
     atgtcagatc gcgaatttag tgcgaacgac gacttgtcgc tacctaaagc gacggtccaa        60
     aagatcatca ccgagatcct acctccttca tccggccaga cattctccaa agatgctcgc       120
     gatctcctca tggaatgctg cgttgaattc atcactttga tctcttccga agcaaacgat       180
     atcagtgaaa aggaagccaa gaagaccatc gcctgcgaac atgtcgagcg cgccctccgt       240
     gatctcggtt tcagcgacta catccccgat gtccttgctg tcgcggagga acacaaagag       300
     cagttgaagt cgcgagagaa gaagcagagc aagatggagc agagcgggtt gtccgaggag       360
     gagcttctac ggcagcaaca ggagttgttc cgctcagcta ctgagaagta tcacgctgct       420
     ccggagtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page