(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE109

ASPNC_1.PE109        Location/Qualifiers
FT   CDS_pept        288459..289091
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234460" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875712"
FT                   /orf_name="An01g01190"
FT                   /product="Similarity: the predicted A. niger protein
FT                   contains a phosphoglycerate mutase motif "
FT                   /protein_id="CAK43495.1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI0000EF9D97"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7L9"
FT                   /transl_table=1
FT                   /translation="MALKVHLVRHAESVHNVTHDFSQLDPELTPLGLQQATGLGQLFPY
FT                   APQVGVIITSPLKRAIQTTLTAFSHILDKRYFDPDSGDGVENGAVLFLEPDLQERSALP
FT                   CDTGSPTRVLEAAFPRLGFQDLAEGWQVKEDFYSPADEAVEERAQRMRSRIAAVCEDLQ
FT                   HQGRTDVVVVTHGVFMKFLSGDPDIDLPKAGWRSYAVGTGTVFSKCS"
     atggccttga aggtccatct cgtccgccac gccgaatcgg tccacaatgt cactcatgac        60
     ttctctcagt tggatcctga gttgacccct cttggccttc agcaagctac agggctcggc       120
     cagctattcc cctacgcccc ccaggtgggt gttatcatca cctctccact caaacgagct       180
     atccaaacca ccctcacggc tttttcccat attcttgata aacggtattt cgaccccgac       240
     tctggggacg gagtggagaa tggcgcagtc cttttcttgg aaccggattt gcaagagaga       300
     agtgcccttc cctgtgatac ggggtcccca actagggtcc tggaagcggc ttttccgaga       360
     ctaggtttcc aggatttggc tgagggttgg caagtgaaag aggacttcta ttctcccgcc       420
     gacgaagctg tggaggagcg ggcacagagg atgagatctc gtattgccgc agtttgcgag       480
     gatctgcaac accaaggacg gacagacgtt gtggttgtaa ctcacggggt gttcatgaaa       540
     ttcttgtcgg gagacccaga cattgatctg ccgaaagcag gctggaggag ctatgctgtt       600
     ggaactggaa ccgtcttctc gaagtgctcg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page