(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE119

ASPNC_1.PE119        Location/Qualifiers
FT   CDS_pept        join(complement(310784..310988),complement(310346..310397),
FT                   complement(309947..310232))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875714"
FT                   /orf_name="An01g01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43502.1"
FT                   /db_xref="UniParc:UPI0000EF9DC1"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7M9"
FT                   /transl_table=1
FT                   /translation="MRLLTYLLLTIYATSAVSTDLSVEEECGSLGVMKVDPADLPEGVT
FT                   LADVRKCADHPLGHLPHPGAATGGWHHPPSPDPPASPSPARDAPPAKRLLDEDIDGALD
FT                   LPALAIAPAVIEIGAIPPQQCTRAHHRARSNVYPRKPHRSVPQHGPIFDDNGLPAQPVH
FT                   RAQARPIAKHHIVPNIH"
     atgagactcc ttacctacct ccttctcacc atctacgcca ccagcgccgt atccaccgac        60
     ctcagtgtcg aagaagagtg cggctccctc ggagtaatga aagtcgaccc agccgatctt       120
     cccgaaggag tcactctcgc ggatgtgcgc aagtgcgcag accatccgct gggacatctg       180
     ccgcaccccg gggctgctac aggtggctgg catcatccac cgtcacccga tcccccagcg       240
     tcaccaagtc cggctcggga tgcccctccc gccaaaagac tcctcgatga ggatatcgat       300
     ggtgcgctgg atctgccagc gctggcaata gctcctgcgg tcatcgagat aggagccatt       360
     ccgccgcagc aatgcacccg agcccaccat cgtgcgcgtt ccaatgttta ccctcggaag       420
     ccccacagat cggtccccca gcatggcccc atctttgatg acaatgggct tcctgcccag       480
     cctgtccacc gtgcccaggc acgaccgatt gccaaacacc acatcgttcc caatatccat       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page