(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE120

ASPNC_1.PE120        Location/Qualifiers
FT   CDS_pept        join(complement(312007..312317),complement(311854..311953),
FT                   complement(311706..311804),complement(311419..311610))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110561"
FT                   /orf_name="An01g01310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43503.1"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI0000EF9DC2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N0"
FT                   /transl_table=1
FT                   /translation="MIFSFAPIIGLLSLISPVIATTDPLNYRNIPGYVTSSSLNVTTLV
FT                   DFIKSRSDLSILSEKIDELGGFAQAFDTDPNWKFTFFAPNNDAFELYTGAYFDSFEPTP
FT                   KGKWWLGNTIIHHYVPNSRLTSSSFNETLQRFQTATYLFVGSQMQDGAIVLNQVANVVE
FT                   SDIPVTSTHQHRSSNPTFHGCHKHSLQGVARILSSHIVDFSQPLRIGQACPELLVIIRM
FT                   SCCVVDPAKRN"
     atgatattct cattcgctcc aattatagga ctcctttctt tgattagtcc agtcatagcc        60
     acaactgatc ctctgaacta ccgaaacatc cccggctatg tcacttccag ctccttgaat       120
     gtgacgactc ttgtggattt catcaaatct cggtcggact taagcatcct gtctgagaaa       180
     atcgatgaac ttggcggatt tgcacaagcg tttgacaccg atccaaattg gaaatttaca       240
     ttctttgcac cgaacaacga tgcctttgaa ttatataccg gggcatactt tgatagtttt       300
     gagccgactc cgaaagggaa atggtggctg ggaaacacca tcatacacca ctatgtgcct       360
     aactctaggc tcacatcgag tagtttcaat gagactttgc agcgttttca gactgccacc       420
     tacctctttg tgggatcgca aatgcaggat ggtgcgattg ttcttaatca agtggcaaat       480
     gtggtggaat cagatatccc ggttactagt acccatcaac acagatcttc gaacccgacc       540
     ttccacggct gtcacaaaca ttcattgcag ggagttgctc gaatcctgag ctctcatatt       600
     gttgacttca gtcagccact gcgaataggc caggcttgtc ctgagttact tgtcattata       660
     agaatgtcat gttgtgttgt ggaccctgcc aagagaaact aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page