(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE122

ASPNC_1.PE122        Location/Qualifiers
FT   CDS_pept        join(314474..314546,314593..314644,314786..314841,
FT                   315138..315295,315362..316360,316422..316981,
FT                   317039..317832,317933..317976)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875716"
FT                   /orf_name="An01g01330"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43505.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000EF9DC4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N2"
FT                   /transl_table=1
FT                   /translation="MSLQSRLIVATVHSTTLVSREWHVVDAKFWFLLLVSDRWTDWFLM
FT                   THSLTRRESLVLLRILPGHYLFNYVDPLPIRLSIKHIEPLAKSFWENLRRRTLAGNYPA
FT                   RRQEADWRSIAGKTIPPWGRRSLCMPDSVCQTSPSWRQCSHGKFLNNLNSAYPMPPKSH
FT                   PATANANVGDLPETTNKGEEEIPACQFCRKKKAKCNRAQPCSQCMRSDVLCVYDDRRTK
FT                   PGLRAGAVDQLYRRVETLENMFLGQEMLWQQMWKALFPNTEPPRSLDKGTTAATTLTER
FT                   REQLKASLQEPPPLAAKRSLTVADADNSAPLDCVPLPAKRARVEDEVAPHAAVLEPEPF
FT                   LANSLPDIVLNELVDFYFVNIHPWIPILHVKRFRERMRSPEERGHINCILHAIISVCAR
FT                   FSQNGPNGDTLNLKEIAKKSRQEVILQSTETFSVENLQALVIVAFETINRGRGPSSWSI
FT                   IGSMAGTVEQLQLGVEEDDLYRVKRMGERLIRRMVCLTPSRSWSEAEERRRVFWAVFLM
FT                   DRFCSVSTGWKISLRNADVKRRLPCEGALWEKEQEVCTPYFGISDFKNTSMPNSHSTSM
FT                   DGSEEQAIGAFAYIIEATESLALVTNFYLHHVFLINDASKARLWLVKFKELDLRLIQWK
FT                   IHLPPKWREACVLNEHRVMDPNLTLAHITHNTAVILLHQGIAYPPSHWQYCPIKLPSAS
FT                   SADTCLEAASEIATIANKFLSFSPIFTNPQFSFCLFIAGRTLLAHARYNRVPPSPALNT
FT                   LIANLMEISQRWTRHHDASESQQEESLAFKFATRLIEAQQNRTSASRPSLDIRTTAYSD
FT                   ESKEEMYKDPMRTNQDDLPDYESLSRPLQLASFPSQESTSCTFDPFSLAFPPLPPAFQQ
FT                   DFSPTGLDPLSFYNMQLPSESMSSPLVRGRESVITAIHGE"
     atgtccctgc agtctcggct gatagtggca acagttcatt ccacaaccct cgtgtcgagg        60
     gagtggcatg ttgttgatgc taaattttgg ttcttacttc ttgtctctga caggtggact       120
     gattggtttc tcatgacgca ctctctcacg cggagagagt ctttagtgct cctgcgcata       180
     cttcctggcc attatctatt taattatgtc gatccattgc ctattcgact ttcaattaag       240
     catatcgaac cacttgctaa gtcattctgg gaaaatctcc ggcgtcggac actcgccggc       300
     aattaccccg cccgccgaca ggaagctgat tggcgcagca ttgcggggaa gacaattccc       360
     ccatgggggc gtcggtcttt gtgcatgcct gactctgtat gtcagacatc tccttcctgg       420
     agacaatgtt cacatggtaa atttctcaat aatctcaact ctgcctaccc gatgcccccc       480
     aaatcccatc ccgcaacagc caacgccaac gtaggagact tgccagagac aaccaacaaa       540
     ggagaggagg agattccagc ctgtcagttc tgtcgcaaga aaaaagccaa gtgcaatcga       600
     gcgcagccgt gttcgcaatg tatgcgatcg gatgttcttt gcgtctacga tgatcgacgg       660
     acgaagcccg gtctccgagc tggggcggtc gaccagctct atcggcgcgt cgagacgctg       720
     gagaatatgt ttttgggtca ggagatgctc tggcagcaga tgtggaaggc tttattcccg       780
     aacactgagc ccccgcgatc cctggacaag ggaaccacgg cagccacgac cctgacggag       840
     cgtcgggagc agttgaaggc ttcattacag gagcctccac ccttagcagc gaagaggtca       900
     cttacagtgg cagacgccga caattctgca ccgctggact gtgttcctct cccagccaaa       960
     cgcgcccgtg tggaggacga agtggctccc catgcggctg tcctagagcc cgagcctttc      1020
     ttggccaact ctttacctga catcgtcttg aacgaactgg tggatttcta ctttgtcaac      1080
     atccatccgt ggataccgat actacacgtt aagagattcc gtgagcgcat gcgatcgccg      1140
     gaggaacgag ggcatatcaa ttgcatctta catgccatca tctctgtctg tgcccgcttt      1200
     tcacaaaatg gcccaaatgg cgatacgttg aacttaaaag agatcgccaa gaaaagtcgg      1260
     caagaggtaa tattgcaaag cactgaaacc ttctccgttg agaatctcca agcgctagtg      1320
     atcgtcgcat ttgagacaat taatcgcggc cgtgggccct cctcatggtc tatcattggc      1380
     agcatggcgg gaaccgtgga gcagcttcag cttggcgtgg aagaagatga cctgtatcgt      1440
     gtcaagcgca tgggagaaag actgatcagg cgcatggttt gtctgacacc atctcggtca      1500
     tggagtgaag cagaagagcg tcgccgtgta ttctgggcag tctttctcat ggaccgcttc      1560
     tgcagtgtct cgacaggctg gaagatcagt ctgaggaatg ctgatgtgaa gcgccgtctc      1620
     ccgtgtgaag gtgctctgtg ggaaaaggaa caagaggtct gcaccccgta tttcggcatc      1680
     tctgatttca agaacacttc catgcctaat agtcactcaa cttcgatgga tggctctgaa      1740
     gaacaggcca tcggcgcatt tgcctacatc atcgaggcta ctgagtcact ggccttagtg      1800
     accaacttct atctccacca cgtctttctg attaacgatg ccagcaaggc acgattatgg      1860
     ctcgtcaaat tcaaggaact agatctgcga ctgattcaat ggaaaatcca tttgcctccc      1920
     aaatggcgcg aagcctgcgt cctaaatgaa cacagagtca tggaccccaa tctgactctg      1980
     gcacacatca cccacaatac ggcggtaatt ctgctgcatc agggcatcgc ctatccacca      2040
     tcgcattggc agtactgtcc cattaagctc ccatcagcat cctctgctga tacgtgcctt      2100
     gaagcggctt cagagatagc aactattgct aataaattcc tgtccttttc tcccatcttc      2160
     acgaatcccc aattttcttt ttgtctattc atcgccggcc gcacactcct cgcacacgct      2220
     aggtacaata gggtaccgcc ttcacccgca ctcaacaccc tcattgcaaa cctgatggag      2280
     atctcgcagc ggtggacaag acaccatgac gccagcgaat cccagcaaga ggagagcctg      2340
     gcattcaagt ttgccacccg gctcatcgaa gcccagcaga atcgaaccag tgcatctcgt      2400
     ccgagtctgg atattcgcac gactgcgtat tcagatgaat caaaagagga gatgtacaaa      2460
     gaccccatga gaacaaacca ggatgatctc ccagactatg aatcgcttag cagaccactg      2520
     cagctggctt cattcccttc gcaggagtcc acttcctgca cgttcgaccc attcagtctg      2580
     gccttcccac cgctgccacc agcctttcag caggattttt cgcccactgg tctcgacccg      2640
     ctctctttct ataatatgca attgccgtcg gagtctatgt cttcgcctct tgtccggggc      2700
     agagaatcag ttattacggc aatacacggg gagtga                                2736
//

If you have problems or comments...

PBIL Back to PBIL home page