(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE126

ASPNC_1.PE126        Location/Qualifiers
FT   CDS_pept        join(323769..324420,324515..324541,324757..324783,
FT                   324929..324997,325127..325284,325341..325717,3
FT                   25750..326257)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110562"
FT                   /orf_name="An01g01370"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An06g01030 - Aspergillus niger"
FT                   /protein_id="CAK43509.1"
FT                   /db_xref="UniParc:UPI0000EF9DC8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N6"
FT                   /transl_table=1
FT                   /translation="MISILSLLSLPLFHNLAHAGTIYHSNFTSSLSPFSACNVESPSYS
FT                   TATDGNLTVYFDESYYDGTRDRKGAEICVFEDGTSTNVRQMTKEGWQGFSIYVPSDTYP
FT                   TDKSAIIAQQFCPGGCSSWCGTVEIVNNTLQTTHRAACSTGTTATLVDDIDRDAWHSVV
FT                   VHMRVSEESDGAYEVWWDGEQVYSVEDIDVGFGTWDDNDTLTTGWYFKNGEYCFGRSTL
FT                   ITSLALTKQNAPSESKITTSETNVNVPHYGLGEAELAKNMSSISAALVRRGTEVISARL
FT                   QTSQQPLIKEWIGIFLVFFTVFAFGLAINWVAYTCAEVIATLAAIEDPNSNSTPYIHLD
FT                   NETTNPDDPELSTITTSKPITSDFRTAINHLRTLGGGGFFSTFRGFRMYLAFIWLDAGL
FT                   ALLIPMFIPVPIHMGLVSFMTDFIGRMFLATGKRHGFIYRRMLGYQHWRRIAPVAVLHN
FT                   VVMSVTYSVNLAASRFVGRVIWVILGGEHGKGSSGGNAEGGIGVVLLIMFFLLLTVPVK
FT                   AIFTRVAASMLPEGLDPILPFDRRFGGKVIPEGGSETLSIMEAWTTFEWSARVRYFKVF
FT                   LKALALEVALGVLGGLLVIGELKWLLYSH"
     atgatctcca ttctctcgct actctccctc cctctcttcc acaacctcgc ccatgcaggc        60
     accatctacc acagcaactt cacctcttcc ctatccccct tctccgcttg caatgtagaa       120
     tctccatcct actccaccgc caccgacggc aacctgaccg tctacttcga cgagtcctac       180
     tacgacggca cccgcgatcg caaaggcgcc gagatctgcg tctttgagga cggcaccagc       240
     accaacgtgc gccaaatgac caaggaaggc tggcagggct tttctatcta tgtgccgtcg       300
     gacacgtacc cgacggacaa gagcgccatc attgcgcagc agttctgccc cggcgggtgc       360
     tcctcgtggt gtggcaccgt cgagatcgtg aataatactc tgcagactac gcaccgcgcg       420
     gcttgttcta ctggtacgac ggcgactctt gtggatgata ttgacagaga tgcttggcat       480
     agtgtcgtgg tgcatatgcg cgtgtcggag gaaagtgatg gggcttatga ggtttggtgg       540
     gatggggagc aggtgtatag tgtggaggat attgatgtgg gatttgggac ttgggatgat       600
     aatgatacgt tgaccaccgg gtggtatttt aagaatgggg agtattgttt tggacgctct       660
     actttgataa catcacttgc attgaccaag caaaatgctc catcagaatc caagatcaca       720
     acaagtgaga caaatgtaaa tgtcccgcac tacggccttg gcgaagcaga attagccaaa       780
     aacatgtcat ctataagcgc tgctctcgta cgccgaggca ccgaagtcat atcggctcgg       840
     cttcagacca gccaacagcc tctcattaaa gaatggatag gcatctttct cgtcttcttc       900
     actgtttttg ctttcggcct tgcaataaat tgggtcgcct acacctgcgc ggaagtcatc       960
     gcaaccctag ccgcaatcga agaccccaac tccaactcaa ctccctacat ccacctcgac      1020
     aacgaaacta ccaaccccga tgaccccgaa ctcagcacca tcacaacctc caagccaata      1080
     accagcgact tccgcacagc aatcaaccac ctccgaacgc tcggcggcgg cggtttcttc      1140
     tcaaccttcc gcggattccg aatgtatctc gccttcatct ggctagacgc aggcttagcc      1200
     cttttaatcc caatgttcat ccccgttccc atccacatgg gcctcgtctc tttcatgacc      1260
     gactttatcg gcagaatgtt cctcgctacg ggcaaacggc atgggttcat ctatcgacga      1320
     atgctgggct atcagcattg gagaagaatc gctcctgttg ctgttctgca taatgttgtc      1380
     atgtctgtga cttactcggt gaatctggct gcctctaggt ttgttgggag ggttatttgg      1440
     gtcattcttg gtggtgagca tgggaagggg tcgagtggtg gaaatgcaga gggagggatt      1500
     ggcgttgttc tcctgataat gttcttttta ttgcttactg tgcctgttaa ggcgatattc      1560
     actcgtgtgg ctgcttcgat gttgcctgag ggacttgatc cgattttgcc gtttgatcgg      1620
     cggtttggtg gtaaggtgat accggagggt gggagcgaga ctctgagtat catggaggcg      1680
     tggacaacgt ttgaatggtc tgctcgagtt cgatatttta aggtttttct caaggcgctt      1740
     gctcttgagg tcgcacttgg tgttcttgga ggtctcttgg ttattgggga gttgaagtgg      1800
     ttgctttatt ctcactga                                                    1818
//

If you have problems or comments...

PBIL Back to PBIL home page