(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE129

ASPNC_1.PE129        Location/Qualifiers
FT   CDS_pept        join(complement(335021..335132),complement(334615..334949))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875720"
FT                   /orf_name="An01g01400"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   slr0318 - Synechocystis sp"
FT                   /protein_id="CAK43512.1"
FT                   /db_xref="HOGENOM:HBG326670"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniParc:UPI0000EF9DE4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7N9"
FT                   /transl_table=1
FT                   /translation="MSPIPSYSRPGRGQHFQDAYGFAEACIAGDRMEIAGQTGMSPTST
FT                   DVPPTLEEEVAQAFNNINEVILYTLEKAKPDLRASVKSGWDRVVKIRTYHVQLPQTREK
FT                   IIGLMVENVKKWCPDHQPTWTMLGIEALPFEGQNLEIEVDVFLG"
     atgtccccaa tccccagcta ctcccgcccc ggccgcggcc aacacttcca agacgcctac        60
     ggcttcgccg aagcctgcat agccggagac cgaatggaaa tagccggcca gaccggcatg       120
     tccccgacat caaccgatgt cccacccacc ctcgaagaag aagttgcgca agcattcaac       180
     aacatcaacg aagttatcct ctacacacta gagaaagcca agcccgatct gcgcgctagc       240
     gtcaagagcg gctgggaccg cgtcgtgaag atccgcacct accatgtcca gttgccccag       300
     acccgagaga agattattgg cctgatggtg gagaatgtta agaagtggtg tccggatcac       360
     cagcctactt ggactatgtt ggggattgag gccttgccgt ttgaagggca gaatttggag       420
     attgaggtgg atgttttctt ggggtga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page