(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE130

ASPNC_1.PE130        Location/Qualifiers
FT   CDS_pept        join(complement(335797..335911),complement(335563..335738))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875721"
FT                   /orf_name="An01g01410"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01460 - Aspergillus niger"
FT                   /protein_id="CAK43513.1"
FT                   /db_xref="HOGENOM:HBG331372"
FT                   /db_xref="UniParc:UPI0000EF9DE5"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P0"
FT                   /transl_table=1
FT                   /translation="MKFIPALGALALAASANAAVTGNCTPGLDYCSSVLGDVGGNDAAI
FT                   VDALNRAGQGGNAPWSGYLFHCNADKSLTASVCVFGCANQGAGQSDMCFGL"
     atgaagttca tccctgcatt gggcgctctc gctttggcag cctccgcaaa tgccgccgta        60
     accggaaact gtacccccgg ccttgattac tgctcctcag tccttggaga cgttggggga       120
     aatgatgcgg caatcgtcga tgcattgaac agagctggtc agggaggaaa tgccccctgg       180
     agtggatacc tattccattg caatgccgac aaatcgctta ctgctagcgt ttgtgtcttt       240
     ggttgtgcaa atcaaggggc aggacaaagt gacatgtgct ttggtctgtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page