(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE131

ASPNC_1.PE131        Location/Qualifiers
FT   CDS_pept        join(complement(337659..338198),complement(337537..337604),
FT                   complement(337462..337487),complement(337168..337395),
FT                   complement(336861..337093))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806410"
FT                   /orf_name="An01g01420"
FT                   /product="Similarity to integral membrane protein PTH11 -
FT                   Magnaporthe grisea"
FT                   /protein_id="CAK43514.1"
FT                   /db_xref="UniParc:UPI0000EF9DE6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P1"
FT                   /transl_table=1
FT                   /translation="MHLRCPSDAYHPGCRQNMKKGCLPSKDLDIAGDRSESVRMERNYV
FT                   SASQVQATGYTMIALSSAVVIARFSLIFWKLRSLQVEDGCILLSWACFLAMSIAYIIVT
FT                   PVVYKIDAYTDGKIGPWATMLSDALFMIKVFFANTMLLWASLWSVKLSFLFLYRRLLQD
FT                   LPGEMKWWYAVLFFCIVDLYWGSYLQLYLMPKYACMVHRWGVQYTPRCFALPGFYQNTM
FT                   LSEQVMVLPLRLVVSLRLPLGQKISVAAVFALGTICVIMAVVRVIQIGTRANNDSTPSS
FT                   SWLAFWAVIVGCLPAFAIIYRRTKNTHRYRSSYVGMSSSAYVPQDDVALSEIITDRENA
FT                   GTEDVGLKAFNTTPELPMELSGEE"
     atgcatctcc gttgcccgtc ggatgcttac catccgggct gtcggcagaa tatgaaaaag        60
     ggatgtttgc cgtcaaagga cttggacatc gctggcgatc gctccgaatc agtccggatg       120
     gaaagaaatt atgtctcagc cagccaggtg caggccaccg gctataccat gatcgccttg       180
     tcgtcggcgg tggtcattgc tcggttcagt ttgattttct ggaaattacg gtcgctacag       240
     gtcgaagatg gttgtattct gctgtcgtgg gcctgcttcc tggccatgag cattgcgtac       300
     attatcgtca ccccggttgt gtacaaaatc gatgcgtata ccgatggcaa gatcggtcct       360
     tgggcgacca tgctgtccga tgctcttttc atgattaagg ttttctttgc gaacacaatg       420
     ctattatggg cgtcgctgtg gtccgtcaag ctatcctttc tgttcctcta tcgccgactc       480
     ctccaggact tgccgggtga gatgaagtgg tggtatgcgg tactgttttt ctgcatcgtg       540
     gacctttatt ggggcagtta tctccaactt tacctcatgc caaagtatgc atgcatggtt       600
     caccgttggg gagtgcagta cacaccgaga tgcttcgctc ttccagggtt ttatcaaaat       660
     acaatgctga gtgagcaagt catggtgctg ccgttgcggc tggtggtgtc gctgcgtctt       720
     ccgctgggcc agaagattag tgtcgccgcc gtgtttgcct tgggcaccat ctgcgtgatc       780
     atggccgtcg tgcgagtcat ccagattggc actcgcgcca acaacgacag caccccgagc       840
     agttcctggc tggcattctg ggctgtcatt gtcggctgcc ttccagcttt cgcgatcatc       900
     taccgccgca ccaagaacac ccatcgctac cgaagcagct atgtcggcat gtcctcgtca       960
     gcttacgtac ctcaagatga tgtcgccttg tcggagatta ttacagatag ggagaacgct      1020
     ggcacggaag acgtaggttt gaaggctttc aacactacac cagaactacc gatggaattg      1080
     tctggtgagg agtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page