(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE133

ASPNC_1.PE133        Location/Qualifiers
FT   CDS_pept        join(341069..342041,342129..342172)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158806" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875723"
FT                   /orf_name="An01g01440"
FT                   /product="Similarity to hypothetical protein CAD21096.1 -
FT                   Neurospora crassa"
FT                   /function="catalytic activity"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAK43516.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG323871"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniParc:UPI0000EF9DE8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P3"
FT                   /transl_table=1
FT                   /translation="MQMSSTHPNTSYTLAWICALPEEYEVAIAFLDEIHGIPQHQPLED
FT                   KNAYLLGRIGQHHVVMVCLPAGRMGTAAAASVAENLCRTFWSVRYGLLVGIGGGVPGVV
FT                   SGKDIRLGDVVVSVPGGGNGGVVQYDLEDGEVHHGQLNSPPEKLLSYVTLLNILMRSPR
FT                   ISGNCFREQLELLGQEYEYPAHLEDRLFCSRYWHQFEGGCEACGNNCGEIYRNKRDDTL
FT                   PAVHLGTIASGNTVVGDGVTRDMINHRYGNSILCFEMEAAGIMNALPCLVVRGISDYAD
FT                   SRKNDEWRPRAIAGACSYAKALILHIPREEVPQHENLVHVTDLDKGGYCWSLAFTER"
     atgcaaatgt cctccaccca ccccaacacc tcctacaccc tcgcctggat ctgcgccctc        60
     cccgaagaat acgaagtcgc gatcgccttc ctcgatgaaa tccacggcat accacagcat       120
     caacctctcg aagataagaa tgcctatcta ttagggagaa taggtcaaca ccacgtcgtg       180
     atggtctgtc tgcctgcagg acggatgggg acagcggctg ctgcttctgt agcggagaat       240
     ctgtgtcgga cgttttggtc agtgaggtac gggttgcttg ttggtattgg aggtggtgtt       300
     cccggtgtag tctccgggaa ggatattcgg ttgggagatg tggtggttag tgttccgggg       360
     ggtgggaatg gaggggttgt gcaatatgac cttgaagacg gtgaagtaca ccatgggcaa       420
     ctcaactccc cgccggagaa gttgctatct tatgtgacgc tgctgaatat tcttatgcgg       480
     agtccgagga tatctgggaa ctgctttcgg gagcagttgg agcttcttgg gcaggagtat       540
     gagtatcctg ctcatcttga agataggtta ttctgttcac ggtattggca tcagtttgag       600
     ggaggctgcg aagcttgtgg caataattgt ggtgaaatat acaggaataa gagggatgat       660
     acactacctg ctgtgcattt aggtacgatt gcttcaggga acacggttgt tggtgatgga       720
     gtgacgaggg atatgataaa tcatcgatat gggaactcca ttttgtgttt cgaaatggag       780
     gctgcgggaa ttatgaatgc cttgccttgt ttggttgtta gaggtattag tgattatgca       840
     gactcgagga aaaacgatga gtggcggccg cgtgctattg ctggtgcttg cagctatgca       900
     aaggctttga ttttgcatat tccgcgggag gaggtgccgc agcacgagaa tctcgtacat       960
     gtgacagatc tggataaagg cggctattgc tggtctctgg catttacaga aaggtga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page