(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE136

ASPNC_1.PE136        Location/Qualifiers
FT   CDS_pept        join(complement(348273..348877),complement(348060..348180))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959662"
FT                   /orf_name="An01g01470"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An08g11970 - Aspergillus niger"
FT                   /protein_id="CAK43519.1"
FT                   /db_xref="UniParc:UPI0000EF9DEB"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7P6"
FT                   /transl_table=1
FT                   /translation="MPFIDFQSPSLYNLSAIGILREGPVWGVSGEHMAYLMYDSNELQE
FT                   AKTNIVTIHDDPTIIKKMIDYFYRGDYDDSPDKSHLATNPDYESPTTKAHVNIEMYNVA
FT                   DKYAIEPLMALAKKKLEYRLTLVWDNKEFIHIIEKVYGLDSPQNSKLRETIAKFAVEHL
FT                   ATLIKLPRFDEVRIEFPLFSYDFSTSLIQRMARVETKLRDHEEYFLSLPLSYIVVMFIV
FT                   FIARGSAWNVVNLSMIGKV"
     atgccattca tcgactttca aagtccatcg ctgtataatc tgtccgcaat cggaattctt        60
     cgagaaggcc ctgtgtgggg agtttcaggt gagcacatgg catatctcat gtatgactct       120
     aacgagttac aggaggccaa aacaaatatc gttactatcc acgacgatcc cacgatcatc       180
     aagaaaatga tcgattattt ctatcgtgga gactacgacg attctccgga caagagtcac       240
     cttgccacga atcctgacta tgaatctcct accaccaagg cgcatgtcaa tatagaaatg       300
     tacaacgttg ctgataaata tgccattgaa ccacttatgg ccctggcaaa gaagaagctg       360
     gagtacagac ttaccctagt ctgggacaac aaggaattca tccacattat cgagaaagtc       420
     tacgggttgg atagcccaca aaactcgaag ctgcgggaga caatagccaa gttcgccgta       480
     gagcatcttg ctacgcttat aaagttgcct cgatttgacg aggtgcgcat tgaatttcca       540
     ctattttcat acgacttctc cacatcattg atccaacgaa tggctcgtgt ggaaacgaaa       600
     ctacgagatc atgaagaata ttttctttct ctaccattgt cttatattgt cgtgatgttt       660
     attgtattta tcgcgagagg ttctgcctgg aatgttgtaa acctttcaat gatcggaaaa       720
     gtttga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page