(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE146

ASPNC_1.PE146        Location/Qualifiers
FT   CDS_pept        join(complement(373209..373609),complement(372498..373151),
FT                   complement(372140..372431))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110563"
FT                   /orf_name="An01g01580"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g00420 - Aspergillus niger"
FT                   /protein_id="CAK43529.1"
FT                   /db_xref="UniParc:UPI0000EF9E02"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7Q6"
FT                   /transl_table=1
FT                   /translation="MNTPGTVYTPDPMDIDESMDSASSTTSSDPMDLAPLTETTQSRAV
FT                   SEIGLQPSLRPGGPDAGLTSHLRAQRYKELYPEGTPRWTKEAIQEAQARVERCKPGEVV
FT                   YTTALDGANVDFEVMTERIERNKQGVAIVGLKHFLEFFPAPTDYITPNPGTRHPSLIYS
FT                   NLALGHKFRRLDEEDTDDEDEDPTDKQIAAAHESFNSIFHAWTDSAIYKNMLATLRNLP
FT                   TIKRPVTKIIAFGCNSLCSPKLDKFARERSAYQHAFLLMLRRVLQEMAWTPTDIEILLQ
FT                   DPAYTKLDKKVLGDCGMTVLDSPKAFLLVDDESFVFSCSPDVPVRQIVMDLASPVGMIW
FT                   DAVVAESMSLDTKDPWDITIHRKINQNYNTYNLPKDKRFSMLKIYLRCSDGELSDTECE
FT                   RREEKMRNTMDFVQRNKFLVSWEKDKVQDVYSVYRRMRGSHGSDGSGRN"
     atgaatactc ccggtactgt gtataccccc gatcccatgg acatcgatga gtccatggat        60
     agcgcgtcat ctacaacctc aagcgacccc atggacctgg caccactaac ggaaaccacc       120
     caaagccgtg ctgtttcgga gattggctta cagccttccc tacgacctgg tgggcccgat       180
     gctggtttaa cctcccatct cagggcccaa aggtacaagg aactatatcc agaggggaca       240
     ccccggtgga ccaaagaagc catccaagag gcgcaagcga gagtggagag gtgtaagccc       300
     ggcgaagtcg tgtataccac tgcattggat ggcgcgaatg ttgatttcga agtgatgact       360
     gagagaattg agcgcaataa acagggtgta gctattgttg gcctgaagca tttccttgaa       420
     ttcttcccag ccccaacaga ctacatcacg cccaaccccg gaacgcgcca tccctcactc       480
     atatactcga acctcgccct gggccacaaa ttccgccgtc tggacgagga agacacggac       540
     gacgaagacg aagaccccac cgacaaacaa atagcagccg cacacgaaag cttcaactcc       600
     atattccacg cctggacaga cagcgccatc tacaagaaca tgctagctac tctccgcaat       660
     ctaccgacca tcaaacgccc cgtcaccaag atcatcgcct tcggatgcaa cagcctatgc       720
     agccccaagc ttgacaagtt tgctagggag cgaagtgcct accagcacgc cttcctgctc       780
     atgttacgaa gagtgttgca ggaaatggca tggacaccga cagacattga aattctgctg       840
     caggatccgg cgtacacgaa gctggataag aaggtactgg gcgattgcgg aatgactgtg       900
     ctggatagtc cgaaggcttt tctgttggtt gatgacgaaa gttttgtgtt ttcgtgttct       960
     ccggatgttc ctgttcggca gatcgttatg gatttggcga gcccggtggg gatgatttgg      1020
     gatgcggtgg tcgcggagag tatgtcgctg gatacgaaag atccatggga catcaccatc      1080
     caccgaaaaa tcaaccagaa ttacaatacc tacaatcttc cgaaggataa gcgtttcagc      1140
     atgttgaaga tatatctgcg gtgctcagat ggcgagctgt cggatacaga atgtgaaagg      1200
     agggaagaga agatgcgaaa cactatggac tttgtccaga ggaataagtt tctggttagt      1260
     tgggagaagg ataaagtgca ggatgtgtat tccgtttatc gccggatgag agggtctcat      1320
     gggagtgatg gaagtggtag aaactag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page