(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE151

ASPNC_1.PE151        Location/Qualifiers
FT   CDS_pept        join(complement(388387..388549),complement(387878..388215))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234464" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875733"
FT                   /orf_name="An01g01630"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An09g00510 - Aspergillus niger"
FT                   /protein_id="CAK43534.1"
FT                   /db_xref="HOGENOM:HBG329760"
FT                   /db_xref="UniParc:UPI0000EF9E07"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R1"
FT                   /transl_table=1
FT                   /translation="MKSSVISALALAAGALAAPSAEIESNLEKRNPSGSFSLYAWGVAA
FT                   SGLKFFYSDVVITDTELITTATTDGVTLDSDTLFYIRPTADEILPVGFTGNGIDTPSDA
FT                   VTDDFIFYGSYLMWEESSGELSDVFRLKETNVSDVYQVYWDTSSLDESGYYYPTVKDTA
FT                   PSS"
     atgaagtcgt ctgttatctc cgccttggct ctggccgctg gtgctcttgc cgctccgtct        60
     gcagagatcg aatctaatct tgagaagcgc aaccccagcg gatctttcag tctgtatgcc       120
     tggggtgtcg ccgcttcagg actcaagttc ttctattctg acgtcgtcat caccgacacc       180
     gaactcatca ccaccgccac caccgacggc gtcaccctcg actctgacac cctgttctat       240
     atccgtccca cagctgacga gatcctgcct gttggcttca ccggcaacgg aatcgatacg       300
     ccttcagatg ccgtcactga tgacttcatc ttctatggct cttatctcat gtgggaggag       360
     tcatcgggcg agttgagcga tgttttccgt ctcaaggaga ccaatgtctc cgatgtttat       420
     caggtgtact gggacacgtc gagcttggat gagagtgggt attattatcc gactgttaag       480
     gatacggcgc cttctagtta g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page