(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE153

ASPNC_1.PE153        Location/Qualifiers
FT   CDS_pept        join(complement(391478..392273),complement(391218..391243))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875734"
FT                   /orf_name="An01g01650"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g05420 - Aspergillus niger"
FT                   /protein_id="CAK43536.1"
FT                   /db_xref="UniParc:UPI0000EF9E09"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R3"
FT                   /transl_table=1
FT                   /translation="MSNISINSPDPTPYSSPKRKQTTANAAKTFPLFSFLPAELRHQIW
FT                   QFALPEPSHPPSALLPHRKGCWVAKPIPYTGELGQVNDPNGNYEIIFDMGLLDRVQIHT
FT                   PLLHVNSESRAIAQKWASNVTAPRRNCLSEKQIQDQMYNDDDSSEDIPPFSRQFDIDCD
FT                   LLYLVPNNIVDLILGAGDRLEQPDMNGKAARVVFSLPLAVVSEEVIWLKDETLLEEIMD
FT                   LFSILGLIHLVVGEQPKWMEGGVQKWWDLEWVSKRAFVWQWMEKPTVYCAP"
     atgtcgaaca tttccattaa ttcacccgac ccgaccccat acagctctcc caaaagaaaa        60
     caaacaacag ccaacgcagc aaaaacattc cctctcttct ccttcctccc cgccgaactc       120
     cgacaccaga tctggcaatt cgcccttcca gaaccctccc accctccctc cgccttactc       180
     ccccatagaa aaggctgctg ggtcgccaaa cccatcccct acaccgggga attgggacaa       240
     gtcaacgacc ccaatggcaa ctacgaaata atattcgaca tgggtctact ggaccgtgta       300
     cagatccata ctcccctact acacgtgaac agcgaatccc gagccattgc gcagaaatgg       360
     gcgtcaaatg tgactgctcc acgaagaaac tgcctcagtg aaaagcagat ccaagatcag       420
     atgtacaatg atgatgatag tagcgaagat atacccccct tctcccgcca attcgacata       480
     gactgcgacc ttctctacct cgtcccgaac aacatcgtgg atttgatcct cggggcaggg       540
     gaccgtctcg agcagcccga tatgaatggc aaggcggcga gagtggtatt ttcgttgccg       600
     ttggcggtgg tgagtgagga ggttatctgg ttgaaggatg agacgcttct ggaggaaatc       660
     atggacttat tttcgatctt gggactgatt catcttgttg tgggggagca gccgaagtgg       720
     atggagggtg gagtgcagaa gtggtgggat ttggagtggg tgtccaagag ggcgtttgtt       780
     tggcagtgga tggagaaacc cactgtatac tgtgctccat ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page