(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE159

ASPNC_1.PE159        Location/Qualifiers
FT   CDS_pept        join(402426..402517,402563..402644,402841..402993)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875740"
FT                   /orf_name="An01g01710"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43542.1"
FT                   /db_xref="UniParc:UPI0000EF9E0F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7R9"
FT                   /transl_table=1
FT                   /translation="MSMTHDFNGLEKLDLIDDEAIIQAIRHEIPSNGFECSVKSISDSD
FT                   GVLGDERRFYIRAINDHERGHTTTQAVLATVPGCALVSPGEDTDCASLELQEQLTRGMR
FT                   DPIN"
     atgtccatga cacatgattt taatggctta gaaaaacttg atttgataga tgatgaagcc        60
     attatacagg ctataaggca tgagatacca agcaatgggt ttgaatgcag tgtcaaaagc       120
     atttctgatt ctgatggtgt actgggagac gagcgaagat tttatattcg agcgattaat       180
     gatcacgaac gtggtcacac caccactcag gcggtcctag caaccgtccc tggttgtgcg       240
     ttggtttctc caggtgaaga cacagattgc gcttccctag agctccagga acaactcact       300
     cgagggatga gagaccccat caattga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page