(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE161

ASPNC_1.PE161        Location/Qualifiers
FT   CDS_pept        join(complement(412652..412676),complement(411539..412548))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20653767"
FT                   /orf_name="An01g01730"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An12g06350 - Aspergillus niger"
FT                   /protein_id="CAK43544.1"
FT                   /db_xref="UniParc:UPI0000EF9E25"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S1"
FT                   /transl_table=1
FT                   /translation="MMPSRLIELQLSLLSSSIRHSTNTISTMSASPFGRFTGLPSEIRL
FT                   LIWEELVKGGSLAILRTSQAIYHDIADRLYDTFDIHLTTLLEDPWIEIRCKRLCASWVI
FT                   GRQDFLKFSDLTRVPYDKVKLVVHIYAPDPDDCGQFILLWEKISRLTRMLCHADVSRNY
FT                   YIYWCGLGYERLRHSEPSPETFISMVIRLRKHNGVDWISDGQLTSTFCTEGLGYDFNEV
FT                   LLPFCRLSRVRRFRVIPDTEEMADAADWGFVNYASAFIMSEGFVTSNDTFYSDDPEYRD
FT                   IARTFDSIEGLVDGRDDFILALDAFYLPHISGHTAALMCREHYTLLLDTMVWRKPIPEK
FT                   HYTR"
     atgatgcctt caaggctaat tgaactacaa ctatccttac tctcttcatc aatcaggcat        60
     tcaaccaaca ccatatcgac catgtccgct tcaccatttg gtcgtttcac cggtttgccc       120
     tccgaaatac gcttgctcat ctgggaggag cttgttaaag ggggatccct tgcgattctt       180
     cgaactagtc aggcaattta ccacgatata gccgaccgtc tttacgacac atttgatatc       240
     catcttacca cacttctaga agatccgtgg atcgaaattc gctgcaaacg actatgcgcc       300
     agctgggtga tcggaagaca agattttctc aaatttagtg atctgacaag ggtaccatac       360
     gacaaggtaa aacttgttgt tcacatatat gcgcctgatc ctgacgattg cggccaattc       420
     atcttgctct gggagaagat atcaagactg acccgaatgc tgtgccacgc agacgtctca       480
     agaaattact acatatattg gtgtgggctg ggttacgaac gattacgtca cagcgaacct       540
     agccccgaaa ctttcatatc tatggtgatt cgcctacgca agcataatgg tgttgactgg       600
     attagcgacg gccaacttac ttcgacgttt tgcactgaag gtcttgggta cgacttcaac       660
     gaagtcttat tgccattctg tcgtctatcc cgtgttagaa ggtttcgtgt cattccggac       720
     acagaagaaa tggctgatgc agctgactgg gggtttgtca actatgcaag tgcgttcatc       780
     atgtcagaag gttttgtcac ttccaacgac acgttctaca gtgatgaccc cgaatacagg       840
     gatatagccc gtaccttcga tagtatagag ggcttggtgg acggcagaga cgactttatc       900
     cttgccttgg acgcatttta tctgcctcac atttccgggc atactgcagc actcatgtgc       960
     cgtgagcatt acactttgct tcttgacacg atggtctgga ggaagccaat accagagaag      1020
     cactacacac gatga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page