(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE168

ASPNC_1.PE168        Location/Qualifiers
FT   CDS_pept        join(427645..427869,427923..427994,428048..428413,
FT                   428463..428507,428554..428780,428831..429392,4
FT                   29571..429702)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216867" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875744"
FT                   /orf_name="An01g01800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43551.1"
FT                   /db_xref="UniParc:UPI0000EF9E2C"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7S8"
FT                   /transl_table=1
FT                   /translation="MDYIAPSLISQLSSILQNPSFPAHLQSAVHAVWHSQDSRQKSASE
FT                   ENGYPQLHLRIEASIVTDVTTSKQTSDLVLGYIDLRSGQAVPLPPTPVSTPDSTINTEY
FT                   ATISTDSNGGRDNSTAQSHPHKRRKTVSALRPAKATTIQPDESRDHEYESLDLEAAADS
FT                   SGTKPSVRQVHSDTRFPQRKNPRQEYSLPVLEPTSADKLIAGIWRQLHSPVKLSRLPSI
FT                   IQSNTDIRTGVSLEVSREINTLCLKYYNQSQSSRALEMIVQAYWIECFEARVAVVRLEK
FT                   PHLSTTDARMMVLKEACVVLNWKEKDLRNRMAIWRGYKEIKDTGGWACLIFASTGIYRF
FT                   CKYRTEFGEGLFTRLRHLQSSFEVAADTLHPGWRDLLQVIRQNTSCVYHGHPHEWVNMS
FT                   EGAAVPLASTYEHLDLPQGLQYQFIEECVLDRTHFGTHDPRRVPELDPDLCLVCKERQS
FT                   DEIQKNQCLCFPALFGGVRHPVPVQVFRTSTGKNNGVIARCVVRAVEHTKYIRGRWAIS
FT                   PDLSTTPVGRTASSNGSTGGAWSAL"
     atggactata tagcaccatc actgatctca caattgtcca gcattcttca aaatccatct        60
     ttcccagcac atcttcagtc agccgtacat gctgtctggc acagccagga tagcaggcag       120
     aagagtgcaa gtgaggaaaa tggctaccca cagctccacc ttcgaattga agcatcaata       180
     gtcactgacg tgacgacgtc taaacagaca agtgatttag tcttgggata cattgatctt       240
     cgaagtgggc aggcagtgcc gttgccaccc acacccgttt caacgcctga ctctacaatt       300
     aatacagaat atgctaccat cagcaccgac tcgaacggcg gccgtgataa tagcactgct       360
     cagagccatc ctcacaagcg gcgcaagacc gtaagcgcgc ttcgaccagc aaaggcgaca       420
     accattcagc cagatgagtc aagagatcat gaatacgaaa gcttagattt ggaagccgct       480
     gccgattcta gtggaaccaa gccatctgta cgacaggtcc acagtgacac ccggtttccg       540
     caacggaaga acccacggca ggagtattca ttacctgtgc tggaaccgac ttcagccgac       600
     aagcttatag caggaatatg gcgacaacta cattcacctg tgaaacttag ccgacttccc       660
     tcgatcatac aatcaaacac ggatatccgc actggtgtta gtctcgaggt atcccgtgag       720
     ataaatacat tatgcctgaa atactacaat caaagccagt cctctcgtgc tctggaaatg       780
     atcgtccaag catactggat agaatgtttc gaagcacgcg ttgccgtcgt tcgactagag       840
     aagcctcatc tttcgacaac agatgcgcga atgatggttc ttaaggaggc ttgcgtggtt       900
     ctaaactgga aggaaaagga tctccgtaat cgaatggcaa tctggcgcgg ttacaaagaa       960
     atcaaagata caggcggttg ggcctgcctg atattcgcca gtactggcat ctaccgattc      1020
     tgcaaatatc gcacagaatt cggcgaggga ctatttaccc gtctacggca tctccaatcc      1080
     agcttcgagg tagcagctga tactcttcac ccgggatgga gggacctcct acaggtcatt      1140
     agacagaata cgtcgtgtgt ctatcatggc catccgcatg agtgggttaa tatgtcggag      1200
     ggtgctgctg tccccctagc ttcgacatac gagcatcttg accttcctca gggattgcag      1260
     taccagttca ttgaagagtg tgtgctagac cgtactcatt ttggaacaca tgatccacgt      1320
     cgggtaccag aactagaccc cgatctgtgt ctcgtatgca aggaaagaca gtcggacgag      1380
     attcagaaga accagtgcct gtgtttcccg gcgttattcg gtggcgttcg tcatccggtg      1440
     ccagttcagg tctttcgcac gtcgactggc aagaataatg gcgttattgc gcgctgtgtg      1500
     gttcgcgcgg tcgagcatac caaatatatc aggggcagat gggcaatttc acccgattta      1560
     tcaaccactc ctgtcggccg aacagccagt tccaacggtt ctactggcgg ggcatggagc      1620
     gcattatag                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page