(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE17

ASPNC_1.PE17         Location/Qualifiers
FT   CDS_pept        join(40931..40975,41097..41687)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874686"
FT                   /orf_name="An01g00170"
FT                   /product="Remark: RAD52 Inhibitor "
FT                   /biological_process="protein transport"
FT                   /protein_id="CAK36868.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG329774"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0000EF9EED"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C4"
FT                   /transl_table=1
FT                   /translation="MVRKDPIFEARTNVKLHSNRLKKEAARAEATFKSEKAKADKAMKN
FT                   REFQIARIHAASAVREKRRQVTLKAEAARADVIINELKAAQSTRDTSRTLALASRGLDA
FT                   ASKSVNLESLVSHANNFLARSEDFKIASSAIEDVAQGVSLQENGAEGEADVDRLMEQLA
FT                   DDAGVDLRMALEQDAAAAPKEEVKAPKQVDTELEDGLDARLRALRATN"
     atggttcgga aggatcctat ctttgaagcc cgcaccaatg tcaagctaca ctctaatcga        60
     ctgaaaaagg aggccgcccg tgctgaagcg accttcaaat ccgagaaggc caaggctgat       120
     aaggccatga aaaaccgcga atttcagatc gcccgcattc atgccgcttc tgccgtacga       180
     gagaagcgca gacaggtgac cctcaaggcg gaggctgccc gagcagatgt catcatcaac       240
     gagctcaagg ctgcgcagag cactcgggac acatctcgaa cactagcgtt ggcatcacgg       300
     ggcttggatg ctgcttccaa gagtgtaaat cttgagagct tggtttccca tgcgaacaat       360
     ttcctggcgc gctctgaaga tttcaagatt gctagcagtg cgatcgagga tgttgcacaa       420
     ggggtctctt tgcaggagaa tggcgcagag ggtgaagccg atgtggatcg cttgatggag       480
     caacttgctg atgacgctgg ggtggatctc cggatggctt tggagcagga tgctgctgct       540
     gctcctaagg aggaggtaaa ggctcctaaa caggtcgaca ctgaacttga ggatgggttg       600
     gatgctaggc tacgcgctct cagggcaacc aactga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page