(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE174

ASPNC_1.PE174        Location/Qualifiers
FT   CDS_pept        join(complement(444900..445109),complement(444536..444751))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875748"
FT                   /orf_name="An01g01860"
FT                   /product="Remark: Homology is only based on repetitive
FT                   sequence"
FT                   /protein_id="CAK43557.1"
FT                   /db_xref="UniParc:UPI0000EF9E43"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T4"
FT                   /transl_table=1
FT                   /translation="MPGGLHPPLSVMESWPARNTINPESHGSASIVLPAIFGSIAVTAV
FT                   ILRLWARCVIQRQGKLDDFFIALALEPTTTAKTTTYGTTRSPNSSSRANSPSRKNSSTS
FT                   SPRASPRSPCYFSTAAWATAPPSPLASSTSSTSASPA"
     atgccagggg gcctgcatcc accgctgtcg gtcatggagt catggcccgc gcgcaacacc        60
     atcaatccgg aatcccatgg ttcagcgtcc attgtgcttc ctgctatctt cggatccatc       120
     gccgtcacgg cagtcatact tcgcctctgg gcacgctgcg tcattcagcg acagggaaaa       180
     cttgatgact tcttcatcgc attagcactc gagcctacaa ctacggcgaa aaccaccacg       240
     tatgggacaa cacgctcccc caactcctcc agtcgcgcaa actcgccatc gcgcaagaac       300
     tcttctacat cctcgcctcg tgcttcacca agatctccgt gctacttttc taccgccgca       360
     tgggccaccg caccaccatc tcccctcgct tcctcaacat catctacctc agcatcgcca       420
     gcgtag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page