(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE176

ASPNC_1.PE176        Location/Qualifiers
FT   CDS_pept        complement(449958..451163)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15875749"
FT                   /orf_name="An01g01880"
FT                   /product="Catalytic activity:"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAK43559.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG517781"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000EF9E45"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7T6"
FT                   /transl_table=1
FT                   /translation="MPPPPPYTYQSEVYTHGLRDQKPAITFIASEWENLARARLSANSF
FT                   SYVHGSAGTGETDRKNRSAFQSWSVIPSRLVPSAEFPDLSTTLFGKKYASPIAIAPVGV
FT                   QTIFHPEGERAVARAAAGLDVPYTLSTATATSTEDVAEANGADGKRWFQLYWPGNEHND
FT                   ITVSLLERAKKSGYDVLVVTLDTYILGWRPTDMDNGYNPFLRADSIGVEMGFSDPVFRR
FT                   YIRDKFGKEVEEDKGTAAGEWTKIVFPGVSHSWEDLAFLRSHWEGPIVLKGVQSVGDAR
FT                   RAVECGMQGIVVSNHGGRQMDGGVGSLTVLPGIVDAVGEKIEVLFDSGVRCGADVVKAL
FT                   ALGAKMVLVGRPYVYGLAIAGEEGVRHVLRSLLGEVQLSLHLGGIRSVKKEDLNRDCLV
FT                   RE"
     atgccacccc caccccccta cacctaccaa tccgaagtct acacgcacgg cctacgcgac        60
     cagaaaccag ctataacctt catcgccagc gaatgggaga acctcgcccg cgcgcgcctc       120
     tccgccaaca gcttcagcta cgtgcacggg tcggccggga cgggagaaac cgaccgcaag       180
     aaccggtccg cattccagag ctggtccgtg ataccttccc gcctggttcc ctcggccgag       240
     ttccccgatc tatcgaccac ccttttcggg aagaaatacg cctcgcctat tgccatcgcg       300
     cccgtagggg tacaaactat cttccacccg gaaggtgagc gtgctgttgc gcgcgccgcg       360
     gcggggctgg atgtgccgta tacgttgagc acggcgacag cgacttccac agaggatgta       420
     gctgaagcga atggggcgga cgggaagagg tggttccagc tgtattggcc tgggaatgaa       480
     cataatgata taacggttag tttgctggag cgggcgaaga agagcgggta tgatgtgttg       540
     gttgtgacgc tggacacgta tatattggga tggaggccga cggatatgga taatgggtat       600
     aatccgttcc tgagggcaga tagtatcggg gtggagatgg ggttcagtga tccggtgttt       660
     aggagatata tccgagataa gtttgggaag gaggtcgagg aggataaggg gactgctgcg       720
     ggggagtgga cgaagattgt gttcccgggg gtgtcgcatt catgggagga tttggcgttt       780
     ttgagaagcc attgggaggg cccgattgtg ttgaaggggg tgcagagtgt gggggatgcg       840
     aggagagcgg tggagtgtgg tatgcagggc attgtggttt cgaatcatgg gggcaggcag       900
     atggatggag gggttgggtc attgacggtg ttgccgggga ttgtagatgc cgttggggag       960
     aagattgagg tgttgtttga ttccggggtt aggtgtggtg cggatgttgt caaggcgctg      1020
     gcgttggggg cgaagatggt gcttgtgggc aggccgtatg tttatgggtt ggcgattgct      1080
     ggggaggagg gcgtcaggca tgttctgagg agtttattgg gggaggtgca gttgtcgttg      1140
     catttggggg ggatcaggag tgtgaagaaa gaagatttga atagggattg cctggtcaga      1200
     gagtag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page