(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE18

ASPNC_1.PE18         Location/Qualifiers
FT   CDS_pept        join(42813..43555,43613..44137,44190..44328,44431..44462,
FT                   44516..44589,44657..45348)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217773" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874687"
FT                   /orf_name="An01g00190"
FT                   /product="Induction: priB transcript was abundant in
FT                   primordia"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36869.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG329780"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9EEE"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C5"
FT                   /transl_table=1
FT                   /translation="MDSSAALDPNKASHGRQAACLNCXKSKVRCNRGQDDASCSRCKQA
FT                   NVECIIPSHHVGRQKGVKKYALNALIFRGPQADMVKTSKRKGLEKALHQIEQAIKRPRS
FT                   NASGSEAAQKLISDLQEMLSNTREQQLHSEADDQSEDRSYTYHSPRDNNFGDNLSLDDA
FT                   ENPLQLLARASDLQLSPNEARDAHRWPPSTFPQPTGMLPSSTEGSDPAAQSYFVPIRAN
FT                   LDVGPDIDPIDIGLVTPSEAESLFSFFYQNLAHTRWGLDPLVHTVSFVRTQSAFLFTSI
FT                   MAAAALFLPSATALSKRLSRHCKSLAHNVIARRHRSVEIVLAFMVNVPWMEPGSCLGDD
FT                   DTCSYIAMALAVALDLSLNKIVLPSTSFEHSLLRRLAKAETIDAKRALYMDRFDGIEPN
FT                   SAWGRRLLRRRERTWIALFVLERGVCLARGRSYTVPSTALINYCDKWHVSDFADSRDGP
FT                   MNSMAVLRRNLVADAGSEVAQSIKNMIESFYDKWYEIWAPEIGEGHSRSLPPYVEILVT
FT                   HTRLSTYGGVINHPTAPLEVKRFFRAAGLSSALNVLRAAIQGESRLKSMPNNTVIMISF
FT                   AACSALSLSVMPEDSRSSLAPSVHNLIEETAGVLERIGATTRHRNGASVLYGRFLRALV
FT                   RRAPVSAGSQNLKVETGPLQPPPDLDGYCPVASGTQPSSIPTSFIWPEPLRFSAMSDDQ
FT                   IIDAVNRAGTAFGTSVPDVPLDDLMTWDWFDVGNAADFGF"
     atggatagtt ccgctgcgtt ggatcccaac aaagcatctc atggtcgaca agccgcctgc        60
     ttgaactgta rgaaaagcaa ggtccgctgc aaccgaggcc aagatgatgc gtcgtgtagc       120
     agatgcaaac aggccaatgt tgaatgcatc atacccagcc accatgtcgg tagacagaaa       180
     ggggtcaaaa agtacgcgct aaacgcattg atcttccgag gaccccaagc tgacatggtg       240
     aaaaccagca aacgcaaagg ccttgaaaaa gcattacatc agattgaaca ggccatcaag       300
     agaccgagaa gcaatgcatc cgggtccgag gcggcccaaa agctcatatc agaccttcaa       360
     gagatgctca gcaatacacg agaacagcag ttacacagtg aggcagacga ccagtccgag       420
     gatcggtcct atacatacca ttcgccccgg gataacaatt tcggcgataa tctctcccta       480
     gatgatgcag agaatccttt acaactactt gcacgtgcct ccgatctaca gctatcgccg       540
     aatgaggctc gtgatgcaca cagatggcca ccttcaacat ttccccaacc tacaggcatg       600
     ctgccgagta gcaccgaggg aagcgaccct gccgcgcaat catattttgt tcccatccgg       660
     gcaaatctgg atgttggccc agatatagac cccattgaca ttggtcttgt gactccgagt       720
     gaagccgaat cgcttttctc tttcttttat cagaacctcg cacatactcg atggggccta       780
     gaccctctgg tacacaccgt ctcgtttgtg cggacccagt ctgcatttct attcacctct       840
     atcatggccg cggctgcatt gttcctgcca tctgctacag cactgtcgaa gcggctttct       900
     cgacattgca agtccctggc ccataatgtc attgcccgac gccacagatc ggttgagatc       960
     gtcttagcct tcatggtaaa tgttccatgg atggagccag gtagttgcct gggggatgac      1020
     gatacatgtt cctacattgc catggctcta gctgttgctt tagatctctc gttgaacaag      1080
     attgtgcttc catcaactag cttcgagcat agccttctca gaagactcgc taaggccgaa      1140
     actatcgatg caaagagagc cctatacatg gaccgatttg atggcataga accgaactct      1200
     gcatggggcc gaagacttct ccgaaggcga gagagaacgt ggatagcgct gtttgttctc      1260
     gaaagaggtg tatgtttagc tcgcgggcga agctatacag tcccttcaac agcccttata      1320
     aactattgtg ataagtggca tgtatccgat tttgcagact cacgtgatgg gccgatgaat      1380
     tcaatggctg tgctcaggag gaatttggtc gcagatgccg ggtctgaggt agcgcaatcg      1440
     atcaagaata tgattgaaag cttctacgac aagtggtatg agatatgggc gcctgagatt      1500
     ggggaaggtc actcacgctc ccttccaccc tatgttgaaa tccttgtaac acatacgagg      1560
     ctatcgacat atggtggtgt tatcaaccat cctacagcac ctttggaagt caagagattc      1620
     tttcgtgctg ccggcctttc ttctgcactg aacgttctga gagcagctat acaaggagag      1680
     tcgcgattga aatccatgcc gaataacact gtcatcatga tatcctttgc tgcatgctca      1740
     gcacttagtc tcagcgtgat gccagaagac agcaggtcga gtttggcgcc aagtgttcat      1800
     aatttgatcg aggaaactgc aggtgtcctt gagcgtattg gagctactac ccgccataga      1860
     aatggcgcct ctgttctcta tgggcgcttc ctgagagcgc ttgtcagacg cgctcctgta      1920
     agcgcaggct ctcagaacct gaaggtcgaa acggggccgc tacaacctcc gccagacttg      1980
     gatgggtatt gcccggtggc ttccgggaca cagccatcct cgataccgac ctcttttatt      2040
     tggcctgaac cactcagatt ttctgctatg tctgatgacc agatcataga cgcagtgaac      2100
     cgagctggca ccgcatttgg gacatctgtg cccgatgttc cactggatga cctaatgact      2160
     tgggactggt tcgatgtcgg aaatgcggca gattttggct tctga                      2205
//

If you have problems or comments...

PBIL Back to PBIL home page