(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE184

ASPNC_1.PE184        Location/Qualifiers
FT   CDS_pept        join(complement(472301..472604),complement(471917..472243),
FT                   complement(471856..471860))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806417"
FT                   /orf_name="An01g01970"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An04g02750 - Aspergillus niger"
FT                   /protein_id="CAK43567.1"
FT                   /db_xref="UniParc:UPI0000EF9E4D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U4"
FT                   /transl_table=1
FT                   /translation="MGNKVSNISSIPEEFLADDWEEHYARARNPFCGYNYCCCYICGFQ
FT                   YNDSWGMRPVSYRVRGDKSYPRHPNYKAVAQAEGIEEERLRHIEYVPNRWWMWQRMIIH
FT                   REAKSTYRVSGTYLLEQETWRLCVPIMVKGKRVYVDPKVYCMGMKATSPADWVGCTVHA
FT                   RCWELLSHHALGRVAETDLPAVIAALRYRRRVVGSPCKRWEHKMFAED"
     atggggaaca aggtgagcaa tataagctct attccggagg agttcctagc ggatgactgg        60
     gaagagcact atgctcgagc caggaatccg ttctgcggat ataactattg ctgctgctac       120
     atatgtggct tccagtacaa tgactcctgg ggcatgcgcc ctgtctcgta tagggtacgg       180
     ggggacaaaa gttaccctcg tcatccaaat tacaaagccg ttgctcaggc cgaaggcata       240
     gaagaagaac ggctacggca tattgaatat gtgccgaacc gatggtggat gtggcaacgg       300
     atgattatcc atagggaagc gaagtccaca tatagagttt ctggtacata cttattagaa       360
     caagagactt ggaggttgtg tgttcctatc atggtcaagg ggaaaagagt ctacgttgat       420
     cccaaagtgt attgtatggg tatgaaggca acgtctccag cggattgggt aggttgtacc       480
     gttcatgccc gctgctggga actgctgtcg caccatgcgc tgggtcgcgt cgcggagact       540
     gatctgcctg ctgtcatcgc tgcccttcga tatagacgcc gtgtggttgg tagtccatgc       600
     aaacgttggg aacataagat gtttgcggaa gactga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page