(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE185

ASPNC_1.PE185        Location/Qualifiers
FT   CDS_pept        join(473738..474681,474712..475185,475221..475353)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876755"
FT                   /orf_name="An01g01980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43568.1"
FT                   /db_xref="UniParc:UPI0000EF9E4E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U5"
FT                   /transl_table=1
FT                   /translation="MPDFQDVEDVWHEICEYLETRDLFNICLTSRTINHVGTRYLYRKI
FT                   KWDWKGKKSRYRIMSLWTALVQDKDKRSRLCGSVREVHLLGSTPPKDTRIVECPEIQEG
FT                   NPSSLSIIRSDKVPFYQEIDYLRDVVSSVVESPKGRLAWLESIAARNVYALVALLLPLL
FT                   HNLRSLKLDYTFAVNGGYPGQMIESLTSGKEIHSAELQNNFEHLEVFDYGTNALHNNLP
FT                   HSCDNTHIRMRYSSQLIPIFQLQQVKHLKVWLRSRHGLLLARIPDVQMNHWALETLVLD
FT                   HISVMDCALFKVFKRTNKLRSLHLGMNAEEKDFCKYIWNGLRALCGCLEHLSISFSITP
FT                   RSREYRIDTIMWGPLFRHMTAGFFQDFTRLKTLELPIQMLNGFRDIMEVGIQQDLPVTL
FT                   EKLGLRWDFRDVESYDVPTATVRILWVLTEFLRLPDRHQRVPLLQEVIIRLFIGEDGLS
FT                   RTVVDCDDLIEQFNMTVDERTLMLNDVSLDIRGIMPNHRRQSYPSSTHYSLLLPDRQT"
     atgcctgatt ttcaggatgt cgaagatgtc tggcatgaga tatgcgagta tctcgagacc        60
     agagacctct tcaatatttg cttgacatcc cgcactatca atcatgttgg cactcgctat       120
     ctctatcgaa agatcaagtg ggattggaag ggaaagaagt ctcgataccg aattatgtcg       180
     ctgtggacag cccttgtcca agataaggac aaacgcagcc gcctgtgtgg ctctgtccgg       240
     gaggtgcatt tactggggag cactcctccc aaggatactc ggatcgttga atgccccgag       300
     atccaagagg gtaaccctag ctcactctct atcatcagaa gtgataaggt gcccttttac       360
     caggagatcg actatctcag agatgttgtg agtagcgtcg ttgaaagccc gaagggccgt       420
     ttagcatggc tcgagtccat tgcagcgcga aacgtctatg ctttggtggc cctcctccta       480
     cctttactcc ataacctgag gtctctcaag ctcgattaca ccttcgctgt caatggcgga       540
     tatcctggac aaatgattga atctcttacc tctggtaaag agatacattc cgcagagttg       600
     cagaataact ttgagcacct cgaagtcttc gattatggaa caaatgcact gcacaacaat       660
     ctgccgcatt cgtgcgataa tacacatatt cggatgcgtt attcatcaca attgatcccg       720
     atattccagt tacagcaggt caagcacctt aaggtctggc tacgtagccg gcacggcctt       780
     cttctcgcgc ggattccaga tgttcagatg aaccactggg cactcgaaac ccttgtttta       840
     gaccatattt cagtaatgga ctgcgcgcta ttcaaggtct tcaaaagaac gaacaagctt       900
     cgcagccttc accttggtat gaacgccgaa gagaaagatt tctgcaaata catctggaac       960
     ggactgagag cattgtgtgg ttgtctggag cacctgtcga tcagtttctc tatcacacca      1020
     agaagtcggg agtatcgcat tgacaccata atgtggggcc ctcttttcag acatatgacg      1080
     gctggattct ttcaggattt tactcggctc aagacacttg aattgccgat ccagatgctt      1140
     aatggattca gggatataat ggaggttggt atacagcaag atttgccagt aacactggaa      1200
     aagcttggcc tgcggtggga cttccgtgac gtagaaagct acgatgtgcc gacagctaca      1260
     gtgcgcattc tctgggtatt gacggaattc cttcggttgc cggaccgtca tcaacgggtg      1320
     cctctattgc aggaggtgat tatccgtcta tttatcggcg aggatgggct tagtaggaca      1380
     gtggtagatt gtgacgacct gattgagcaa ttcaacatga ctgtggacga acggaccttg      1440
     atgctcaacg acgtatcact ggacatacgc gggattatgc caaaccatcg acgacaatcc      1500
     tacccaagct caactcatta ttctctcttg ttaccagacc gccagacata a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page