(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE186

ASPNC_1.PE186        Location/Qualifiers
FT   CDS_pept        join(476179..476245,476295..476470)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806671"
FT                   /orf_name="An01g01990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43569.1"
FT                   /db_xref="UniParc:UPI0000EF9E4F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U6"
FT                   /transl_table=1
FT                   /translation="MCFTSYSDEPVSPARPRPTSTNEQEGDEADDTMEEAMFLAQLVAE
FT                   GEVGQAVVVVEEEEEEEEAAEEEEMMVEGEAEDEF"
     atgtgcttca cctcatattc tgacgaaccc gtttccccgg cccgtcctcg acccacatcc        60
     accaacgaac aagaaggaga cgaggccgac gatactatgg aggaggctat gttcctggcg       120
     cagcttgtgg cggaggggga ggtggggcag gctgtggtgg tggtggagga ggaggaggag       180
     gaggaggagg ctgctgagga ggaagagatg atggtggagg gggaagctga agatgagttt       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page