(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE188

ASPNC_1.PE188        Location/Qualifiers
FT   CDS_pept        479790..480995
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959923"
FT                   /orf_name="An01g02010"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43571.1"
FT                   /db_xref="UniParc:UPI0000EF9E51"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U8"
FT                   /transl_table=1
FT                   /translation="MDKPTGVASSQMDKPRLGGKMNLPAGGATTAPVRDVSNKKKRALE
FT                   EDSDSENIDDGKRTCIHLIDEAMKDLELGFEKDSEDDYESDSKTESDSDGGSSNDEDRG
FT                   NSSTEETTVIDEDSSNDEDGGDSSTEETTVSDEDSSNDEGSDLGGRDVTMDEIMDFNSE
FT                   ESTSDETMDTSDEDSSRDEASDWSVGSGSSDEEEYMDVSDAESWSSEHWNDSDQSDDED
FT                   YTFERPEAWKWSKDNNINNNKDGDEEDGDRLMIQLTYPNHTHKICDDTSSEDEDGDALI
FT                   QEEVDDASSEDEVETEDENKSGCADGDSSTAFPACEFLDKHADKPGYIYDMTSHGKNIL
FT                   ILITTSSPPTLIRASTRDLIMGSSVFAKVFGYNEEIRVSGKIFSSWRKIQKVTGCHRAE
FT                   FI"
     atggataaac ctacgggagt ggcatcttct caaatggaca aaccccgctt ggggggcaag        60
     atgaacctac ctgcaggcgg tgctactact gcgcctgtca gagatgtctc caacaagaaa       120
     aagcgtgctc tagaagagga cagcgacagc gaaaacattg atgatggtaa gcgaacttgc       180
     atccatctaa tcgatgaagc gatgaaggac ttggagttag gtttcgagaa ggattcagaa       240
     gacgactacg aatctgatag caagacagaa tcagacagtg acgggggcag ctctaatgac       300
     gaagatagag gtaactccag cactgaagag acaactgtca ttgatgaaga cagctctaat       360
     gacgaagatg gaggtgactc cagcactgaa gagacaactg tcagtgatga agacagctct       420
     aatgacgaag ggtcagatct cggtggtcga gatgttacaa tggacgaaat catggatttc       480
     aatagtgagg agagcacaag cgacgagaca atggatacca gtgatgagga cagctcacgc       540
     gacgaagcat cggattggag tgttggaagt ggctcaagcg atgaggagga atatatggat       600
     gtcagtgatg cagagagttg gagttccgaa cattggaatg atagtgatca aagcgatgat       660
     gaggactata catttgaacg accggaagct tggaaatgga gcaaagacaa caacatcaac       720
     aacaataagg atggtgacga ggaggacggt gataggctaa tgattcagct tacatatccc       780
     aatcataccc acaagatctg cgatgacaca tcttcagagg atgaggacgg agatgcactt       840
     atccaagaag aggtagatga cgcatcttca gaggatgagg tcgagactga agacgagaac       900
     aagtcgggct gcgctgatgg tgactcctct accgcattcc ccgcatgtga gtttctcgac       960
     aaacacgccg acaaaccagg ctacatctat gatatgacat cacatgggaa gaacatcctc      1020
     atcctaatca cgacatctag tcccccaact ctcatccgtg cctccacaag ggatctgatc      1080
     atgggatcca gtgtctttgc taaagtattt ggctacaatg aagagattcg agtgtctggg      1140
     aagatattct caagctggcg gaagatccaa aaagtcacag ggtgtcaccg agccgaattc      1200
     atttga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page