(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE189

ASPNC_1.PE189        Location/Qualifiers
FT   CDS_pept        join(481538..481618,481671..481776,481868..481948,
FT                   482007..482041)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876756"
FT                   /orf_name="An01g02020"
FT                   /product="Similarity to hypothetical protein ssl3291 -
FT                   Synechocystis sp"
FT                   /protein_id="CAK43572.1"
FT                   /db_xref="HOGENOM:HBG540835"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="UniParc:UPI0000EF9E52"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7U9"
FT                   /transl_table=1
FT                   /translation="MPLARATFEDIILAESPTWETVEGNIYFPPTAIKDKSLFVPIDKV
FT                   TFCPWKGDASYYSIVVGPTTIPGGAWYYPNPYDAASNIKDHVAFYTTGSIKVSVE"
     atgcccctcg ccagggcaac cttcgaagac atcatcctcg ctgaatcccc aacctgggag        60
     accgtcgaag gaaacatcta ctttcctccc acagcaatca aagacaaatc gctcttcgtt       120
     cccattgaca aggtaacatt ttgtccttgg aagggagacg cgtcatatta ctctattgtg       180
     gttggaccaa caacaatccc cggtggagcg tggtattatc ccaacccata tgatgctgcc       240
     agcaatatca aggatcacgt ggcattttac acaacaggca gcatcaaagt gagcgtggaa       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page