(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE19

ASPNC_1.PE19         Location/Qualifiers
FT   CDS_pept        join(45640..45672,45864..46212,46278..46464,46521..46822,
FT                   46875..46954,47010..47041,47112..47229,47296..47517,
FT                   47601..47735)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806146"
FT                   /orf_name="An01g00200"
FT                   /product="Catalytic activity: succinyl-coa + a 3-oxo acid  "
FT                   /EC_number="2.8.3.5"
FT                   /function="3-oxoacid CoA-transferase activity"
FT                   /biological_process="ketone body catabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAK36870.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008260"
FT                   /db_xref="GO:0046952"
FT                   /db_xref="HOGENOM:HBG353770"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="UniParc:UPI0000EF9EEF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C6"
FT                   /transl_table=1
FT                   /translation="MLSTVATFSEPVKIFLVLPDNTTSLLTHESIAETLISAIHRRGAD
FT                   NLHSLTAVSNNAGLAGKGGLSTLTQAGQVNRLILSYLGNNKALEKKYLTGNIAIELCPQ
FT                   GSLAERLRAGGAGIPAFYTPTGVHTLLQKGEIPVRVDESGKVLERGKPRETREFNGKTY
FT                   MMETALNGDVAILRAWKVDAAGNCVFRYTTKAFGPIMAKAAALTIVEAENIVPVGSIDP
FT                   NDVDLPGIFVDRIVPATDEKHIEIKKLRSDKGDDANKKAEDAATVLRNRIAKRAARELK
FT                   QGYYVNLGVGIPTLAPSFLPEDVKVWIQSENGILGMGPYPTEEEVDADIINAGKETVTL
FT                   VPGAATFDSSESFGMIRGGHVDVSILGALQVSANGDLANYMIPGKVFKGMGGAMDLISN
FT                   PEKTKIVVATSHTAKDGSPKIVDQCSLPLTGANCVSTIITELCVFQVDRTKGELLLTEL
FT                   APGVEVEEIQDKTGAKFSVAENLEIME"
     atgctatcga cggtcgcaac tttctccgag cctgtaaaga tattcttggt attgccagat        60
     aatactacca gtttattaac ccatgaatct attgcagaaa cattgatctc tgcgatacac       120
     cgcagagggg cagacaactt gcactccttg acggcggttt cgaacaatgc tggtctcgcc       180
     gggaagggcg ggctgtctac cctaacgcaa gcgggacagg tcaatagact gatactttcc       240
     tacctgggaa acaacaaagc tctggagaag aaatacttga cgggaaatat tgccatcgaa       300
     ctgtgtccgc aaggcagtct ggccgagcga ctacgtgctg gaggagctgg gatccccgca       360
     ttttataccc ccacgggagt tcacactctg cttcagaagg gagagattcc ggtgcgtgta       420
     gacgaatccg ggaaggtgct cgagcgtggc aagccccgcg agacaagaga gtttaatggc       480
     aaaacttata tgatggagac tgcgctcaat ggggatgtgg cgattctcag agcgtggaag       540
     gtagacgctg caggaaattg tgttttccgt tacactacga aggcgttcgg ccccatcatg       600
     gcgaaggcag cagcccttac tattgtggaa gccgagaaca ttgttcccgt tggctcaatc       660
     gaccctaacg atgttgatct accgggaatc ttcgttgata gaatcgtccc cgcaaccgat       720
     gaaaagcata tcgaaatcaa gaaattgcgg tctgacaagg gtgacgatgc aaacaaaaag       780
     gcagaggacg ctgcgactgt cctacggaac cgaatcgcta agcgggctgc tcgggaactc       840
     aagcagggtt actatgttaa cctcggagtt ggtattccca cacttgcccc ctcgtttctg       900
     cccgaagatg tgaaggtttg gatccaatct gagaacggta tcctgggcat gggcccttat       960
     ccgacagaag aggaagttga tgcggatatc atcaatgccg gcaaagagac tgtcacactg      1020
     gtcccaggcg ctgccacttt tgatagcagt gagtcatttg ggatgatccg cggcggacat      1080
     gtagatgttt caatcttggg agctttgcag gtcagcgcga acggcgacct ggcgaactac      1140
     atgattcccg gtaaggtgtt caagggaatg ggaggagcca tggacttgat ctccaacccc      1200
     gagaagacca agattgtggt tgccaccagc cacaccgcca aggatggatc accgaagatt      1260
     gtggaccaat gcagccttcc tttgactggc gccaactgtg tcagcacgat tatcaccgaa      1320
     ctgtgcgtct tccaggtcga ccggaccaag ggtgagcttc tcttgacgga actggctccg      1380
     ggtgtggagg tcgaggagat tcaggacaag actggggcga agttttcggt tgcggaaaac      1440
     ctggagatca tggaatga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page