(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE191

ASPNC_1.PE191        Location/Qualifiers
FT   CDS_pept        join(487264..487440,487519..487795,487845..488263,
FT                   488317..488964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876758"
FT                   /orf_name="An01g02040"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43574.1"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI0000EF9E64"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V1"
FT                   /transl_table=1
FT                   /translation="MAKPTSDIELSPADLGLPRFVEAHLAIVVRAKPEPHDCQRAAQEL
FT                   LATYPMLAMRMDFWRTKLLHSDYPAEIYHSRTLKKDLDEVLPCQTAKVGPPAVQLLDTC
FT                   SLLDCLNFNRDIWDEICGEQVLRIRVVFLNDAWAVRFIMSHTLGDIRVPVGLNSLLSNS
FT                   MCHTAMHWIADSFFAFLSGREVQTVSPIRSILTFKSDIIDSWNALTASGTTHSVAEDHQ
FT                   HEIVAGWLPTILSGARQILWYAYEASSPRRQVNKSLFIPQCIIDHWVQGARREGIQVTE
FT                   HDLLMGFIYEATYRALSAPPHFTFLMNFHQQLHSPGPLGNTWFQIPIPALHKSKSSPST
FT                   PFPKDHSSTLLPMLLHHAQLIRDIIVKCRHPACFPEIYEQHRRLGTTPWRPRSFGTRSP
FT                   HVMVSCWTKQQWYELDCTGGTPLFVDLGACFYRLFQLLGVQGPDDFVGTIKCPGGRNST
FT                   LMGEHKGYWVQGRLPEVTWATMVDMLTAVSFGDGGGQKQGLGQTFANI"
     atggcaaagc caaccagcga catagagctg tccccggcag acctgggact gcctcgcttt        60
     gtagaagcgc atctagcaat tgtggtacgc gcgaagcccg agccacatga ttgccagaga       120
     gctgcgcaag agctattggc cacgtatcct atgctggcga tgcgaatgga cttttggcgc       180
     accaagctcc tccatagcga ttatcccgca gagatctatc acagccgaac cctgaagaag       240
     gacctcgatg aggtgctacc ctgtcaaaca gcgaaggtgg gacctcccgc ggtacaactc       300
     ctcgacacgt gcagcctact cgattgcctg aatttcaacc gagacatttg ggacgagatc       360
     tgcggtgaac aagtgcttag gattcgtgtg gtattcctta atgatgcgtg ggctgtccgc       420
     ttcataatgt cgcatacgct gggggatata cgagtgcccg tgggtctaaa ctccttattg       480
     tctaattcga tgtgccatac agctatgcat tggattgccg attctttctt cgccttcctg       540
     tccggacgtg aagtccagac tgtctcgccg attcgctcca tcttgacctt caaatccgat       600
     attatcgata gctggaatgc cctgaccgcg tcaggcacga cgcactcagt agccgaagac       660
     catcaacatg agatagtggc tggctggctg ccgacaatct tgtccggggc gcgacagatc       720
     ctctggtacg cctacgaagc cagctcgcct cgacgtcagg tgaacaaaag cctattcatc       780
     ccgcaatgca tcatcgacca ttgggtgcag ggggcgcgtc gagaaggtat acaagtgact       840
     gagcatgatc tgcttatggg atttatctac gaggccacat atcgagccct ctccgcacca       900
     cctcacttca ctttccttat gaatttccac cagcagctcc attcacccgg tcccctgggg       960
     aacacctggt ttcaaattcc tattcctgct ctgcacaaat ccaaatcttc tccttccacc      1020
     ccttttccga aggaccactc atccactctc ctccccatgc tcctccacca cgcccaactc      1080
     atccgtgata tcatcgttaa atgccgccat ccggcctgtt tccctgaaat ctacgagcaa      1140
     caccgccggc ttggaactac cccctggcgg ccccgctctt ttggcacgcg cagcccccac      1200
     gtgatggtat cttgctggac gaaacagcag tggtatgagc tcgactgcac aggagggacc      1260
     cccctattcg tagaccttgg agcgtgtttc taccgactgt ttcagctcct gggagtgcag      1320
     ggcccagatg actttgtcgg cactatcaaa tgccccggtg gcaggaatag caccctgatg      1380
     ggggagcaca aaggttattg ggttcaggga aggctgccgg aggttacctg ggcgactatg      1440
     gttgacatgc tgacggcggt ttctttcggg gatggtggtg ggcaaaaaca aggtctgggc      1500
     caaacattcg cgaatattta g                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page