(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE195

ASPNC_1.PE195        Location/Qualifiers
FT   CDS_pept        join(complement(496831..497234),complement(496672..496771),
FT                   complement(496556..496594))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876760"
FT                   /orf_name="An01g02080"
FT                   /product="Similarity to hypothetical protein SC2G5.30 -
FT                   Streptomyces coelicolor"
FT                   /protein_id="CAK43578.1"
FT                   /db_xref="HOGENOM:HBG325003"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="UniParc:UPI0000EF9E67"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V5"
FT                   /transl_table=1
FT                   /translation="MSSDLPSPSSITSLPQEQQFRVLDTLFESSPELHTLMAPVLANQT
FT                   FSSYATLIDAVGGRMSALSAANSSKDRDILVGILGSHPRLGQPKGAPTEHLSELSKKEQ
FT                   ANLNTGAEEQAEKLKRMNAEYEQKFPGLRFVTFVNGRNRDVIMEEMRERIDRGNADREV
FT                   EEIIQDRARKLEQSAKI"
     atgtcctccg atctcccctc accatcgtca attacatcac tcccgcagga gcagcaattc        60
     cgcgtcctgg ataccctgtt cgagtcgtcg cctgagctgc atactctcat ggcccccgtt       120
     ctcgcaaacc agacattctc ctcctacgcc accctgattg atgctgttgg cggtcgcatg       180
     tctgctctgt ctgctgccaa ctcgtccaag gaccgcgata ttctagtggg gattctggga       240
     tcgcatcccc gcctgggaca gcccaaggga gctccgacag agcacttgag cgaactgagc       300
     aagaaggaac aagcgaatct gaataccgga gcagaggaac aagcggagaa gctgaaacgt       360
     atgaatgctg agtacgagca aaagttccct ggcttgcggt ttgttacttt tgtaaacggt       420
     cgcaaccggg atgtcatcat ggaggagatg cgtgagagga ttgaccgggg caatgccgat       480
     cgtgaggtgg aggagattat acaggatcgg gcgcggaaac tggagcagtc cgctaagata       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page