(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE196

ASPNC_1.PE196        Location/Qualifiers
FT   CDS_pept        join(499043..499116,499239..499426,499537..502572,
FT                   502624..502667)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176423" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110816"
FT                   /orf_name="An01g02090"
FT                   /product="Similarity to hypothetical protein BX908807_12 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43579.1"
FT                   /db_xref="HOGENOM:HBG329791"
FT                   /db_xref="UniParc:UPI0000EF9E68"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7V6"
FT                   /transl_table=1
FT                   /translation="MSLNGLDNPTVIDAYQTALTEAGGWFLLRYVSRDEVALLDRGTGG
FT                   VPDVRNAIDGYEEKSPLYGFLQYRRRKVVLSYLPEGMSRLVQDKFSPHDTVFSVTQPSE
FT                   LTESALSSACLLHTASGSITSSSSSLRRRRLKEIAEDAEETTVGKDENQAQSAADGMPR
FT                   QRSFSQLSEATVVPPSVVSSVQQSPVGNEPTPKTSENASIRERSSSVATSERAPSYKNF
FT                   REDSSYAPSEPRQSSQSARPSVRDLERAGYKAKVKLGPRPSVDGSGRPRTAGNLSRSAE
FT                   RRPVASLPAGVRSSSLRKSNPSPSRPRSSGGHGTPVASRVPAVPPLLVPPFSMPISRPK
FT                   ISPGAKSLSALSSSTTSNEKERLMKALQMRKTQMEKKAKEGKNSSTTEKGEVSGLDMTE
FT                   NKENIGHIPSKMKHDGGDDRMAHLAGPNKEPLSETQPTLQPMLRHQGAEEEDGRTTPNS
FT                   PEPSGSHHSLSQPARLSNSSNEFQATTPTRSGSETQAGDRDLGASNSGGVSGGPSSPTR
FT                   LPSAIAAPLENNSGKAPDEEIVGPSPPKPVPHPVVPGEQEALLHHHHHHHPSTPDVTES
FT                   DLFESPARPDSSHHPSAATFTPNSLSIAAPPPTEPQHDLTPESSNVERQRSTSRKEKRK
FT                   PYLEPIQVPTPDYSDDENLLSDDSFMEELTSATVEEAKPISVGVSPLSPGYSNSSNGNV
FT                   SPDAWRNSRAVSNPSAIGHQSPNMSTIAVGRSVSTTGADSGSQNGPVLVARKINVSSGI
FT                   SSRIKALEKFSNSRDAPSMNGQTLAAPSAASFETLRKGYSGPSMPRPLSYAPESFSRSS
FT                   SVRRPSSQAGPGLAGPGLSRSPSSVSVTARIVRDPTAAETNPNADPSEPAVLNLQPSQI
FT                   TVEQETTELPVLTLQTEPTITQSEDDTLPPSSAGSDQQSSVSVQRPESRISTPTSIKEE
FT                   EEVASPAKSSGDAPSSPDEKKESRATRLLRRMSSITSRKSVVGVLNPIKGDDHVVPIKL
FT                   EEPERPVSRATEVAPAIDIGEVNVQFPDTLLWKRRFVRIDDQGYLILTPGNLDSTNRNL
FT                   VKRYHLSEFRTPCLPDEDRQELPNSILLDFLDGNTLQCACESRQGQTFVLQTLRDAHST
FT                   YQTVSH"
     atgtcgctca atgggctaga taatcccacc gtcatcgatg cctaccagac cgcgctcacc        60
     gaggccggtg gatggtttct cctgcggtat gtatcaaggg atgaggtggc tctccttgat       120
     cgcggcaccg gcggggtgcc cgacgtgcgc aacgcgatcg acggctacga ggagaagtct       180
     ccgctctatg gcttcctaca atatcggcga cggaaagtcg tcctcagcta tctgccagag       240
     ggcatgtccc gcctcgtgca agacaaattc tccccgcatg atacggtatt ctcggtgacg       300
     cagccatcgg aacttacaga aagcgcattg tcctccgcat gcttactgca tactgcttcc       360
     ggttcgatca cttcctcttc cagctccctc cgccgtcgcc gattgaaaga gatcgcggaa       420
     gatgccgaag agactaccgt aggcaaggac gagaaccagg cgcagtccgc ggccgatgga       480
     atgccgcgcc agagatcgtt cagtcagctg tctgaagcca ccgtggttcc cccatcagtg       540
     gtgtcgagtg tccagcaatc accagtcggc aacgaaccaa ccccgaaaac ttccgaaaac       600
     gcctccattc gagagcggtc ttcatcggtg gccacatcgg agcgggctcc ttcctataag       660
     aactttcgag aagactcatc ttatgctccg tcggagcccc gccaatcttc gcagtccgcc       720
     cgaccttccg tccgtgacct ggagcgtgcc ggatacaaag ccaaggtaaa gctgggtcct       780
     cggccttccg tagatggcag cggacgccct cggactgcgg gcaacctctc tcgaagcgct       840
     gaacggcggc cagtggcatc tttgcctgcg ggtgtccggt catcatcctt gcgcaagtcc       900
     aatcccagtc cttcgcgacc tcgatcttcc ggaggccacg ggacccccgt cgccagtaga       960
     gtgccggccg tgcctccgtt actggtgcct cccttttcca tgcccatctc gcggcccaag      1020
     atatcgcccg gtgccaagtc actgagcgcg ctgtcttcgt ccaccacgtc caatgaaaag      1080
     gagcggctga tgaaagcgct ccagatgcga aagacgcaga tggagaaaaa agcaaaggag      1140
     gggaagaaca gttccacgac ggagaagggt gaggtgtccg ggcttgatat gaccgaaaat      1200
     aaggagaaca tcggtcatat accaagtaaa atgaagcacg atgggggcga tgaccgaatg      1260
     gcccacttgg cagggccgaa caaggagccc ctttccgaaa ctcagccaac cctgcagccc      1320
     atgctccgtc atcagggggc tgaagaagag gacggccgta ctactcctaa ttcccctgaa      1380
     ccctcgggca gccaccactc ccttagccaa ccggcacgcc tgagcaacag cagtaatgag      1440
     tttcaggcga cgacacccac tcgttcggga tctgaaacgc aggcgggcga cagggacttg      1500
     ggcgcatcca attccggcgg cgtctcgggt ggccccagct ccccgactag gctgcctagc      1560
     gccatcgccg ctccactcga gaacaattct ggaaaggctc cggacgaaga gattgttggc      1620
     ccctcgccac caaaaccagt cccccatcct gttgttcctg gcgaacaaga ggccctcctc      1680
     catcatcatc accaccacca ccccagcacg ccagacgtga ctgagtccga tctgttcgag      1740
     tcgcctgctc ggcccgattc ctcccaccat ccttcagcag ccaccttcac ccccaattcc      1800
     ttgtcgatcg ccgctccccc tccgacggag ccgcagcatg acttgacccc tgaatcctcg      1860
     aatgtggagc gacagcgcag cacgtctcga aaggagaaac gcaaaccata cctcgaacct      1920
     attcaagtcc caactcccga ctactcggat gacgagaacc ttctctcaga cgactccttc      1980
     atggaagaat tgaccagtgc cacggttgag gaggctaagc ccatctctgt gggcgtctct      2040
     cccctctccc cgggctactc aaacagcagc aacggcaacg tctcacctga tgcgtggagg      2100
     aattctcgtg ccgtttcaaa ccccagcgcc attggacacc agtcccccaa catgtcgacc      2160
     atagccgtgg gccgttccgt ctcgacgacg ggtgcggatt ctggttccca gaacgggccg      2220
     gtcctggtgg cgaggaagat caacgtctcg tcgggcatct ccagccgcat caaggcattg      2280
     gagaagttct ccaacagtcg cgacgcccca tcaatgaacg gccaaaccct cgccgctccg      2340
     tcggcggcct ccttcgagac cctccgcaaa ggctactcgg gaccttccat gccccgacct      2400
     ctctcatacg cccctgaatc cttctcgcgg tcatcgagcg tgagacgacc tagctcacag      2460
     gcgggccctg gcctcgctgg tcctggcctt tcgcgctccc caagctcggt ctctgtgact      2520
     gctcgcattg tccgcgatcc caccgctgct gaaaccaacc cgaatgccga cccgtccgag      2580
     ccggccgtcc tcaacctaca acccagccaa attaccgtcg aacaggaaac tacagagctc      2640
     cctgttctga ctttgcaaac agaacctaca atcactcagt cggaagatga taccttgccc      2700
     ccgtcctctg ctggatccga ccagcaatcc tccgtgtccg tacaacgtcc ggagagccga      2760
     atctccaccc ccacctctat caaagaagaa gaagaggtgg catcacccgc caagtcatct      2820
     ggcgatgcgc cctcctcccc tgatgagaag aaagaatccc gtgcgacgcg acttctgcgc      2880
     cgcatgtcct ctatcacttc ccgtaagagc gttgttggtg tgttaaaccc tatcaaggga      2940
     gatgaccatg tggtccccat taagcttgag gaacccgaga ggcccgtctc gagggcaacg      3000
     gaggtggctc cggcgatcga tattggcgag gtcaatgtac agtttcccga cactctcctg      3060
     tggaagcgtc ggtttgtccg aatcgatgac cagggttatc tgattctgac acctggcaat      3120
     ctggactcca ctaaccgcaa cttggtcaag cggtatcatc tgtccgagtt ccgtactccg      3180
     tgcctgccgg acgaagaccg ccaggagctg cccaacagca ttctgctgga tttcctggac      3240
     ggcaacactc ttcagtgcgc ctgcgagtcg agacaggggc agacctttgt gcttcagacg      3300
     cttcgcgacg ctcacagcac ctaccagacc gtctctcact ag                         3342
//

If you have problems or comments...

PBIL Back to PBIL home page