(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE20

ASPNC_1.PE20         Location/Qualifiers
FT   CDS_pept        join(complement(50042..50388),complement(49702..49963),
FT                   complement(49243..49641),complement(48862..49182),
FT                   complement(48573..48806))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959385"
FT                   /orf_name="An01g00210"
FT                   /product="Similarity to hypothetical protein AAO27753.1 -
FT                   Fusarium sporotrichioides"
FT                   /protein_id="CAK36871.1"
FT                   /db_xref="UniParc:UPI0000EF9EF0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7C7"
FT                   /transl_table=1
FT                   /translation="MSRYLRAFVLALAGSTLVASASTSTSNSNSWCQTSWSTDTCQLFT
FT                   ESMEYLDRIYDASAGYVYDPSAATALRHDTRTSVWYAVGLLARDQGDDVAQAMTIIRNV
FT                   IDAQFKDTSDQWYGDYQQFPEEPTVGTSAYPPIIYDTWDPNWREFIGTAFIIALEEFPH
FT                   LIDADMTQLMHASLYNDTVGDSYRVGGVDDDNLYPSYTNPSLMRAIITGWTGRKLGDQN
FT                   MTNSGETYATEIIRLFDRADTLSEFNSATYTGVSLIALTMWAKYAAEDSVMKGKGKEML
FT                   QDTWDTIGELYHAGLKNLAGPWDRAYGFDMQKYFGIMSGHIWSLVGKETSPVIDKVYMM
FT                   SHNSDFSISPLIAILSNFHNSLVPSTAIQALKTFPGEHMVNTSAYSIPYDSFPRQVAAW
FT                   LSEGISIGAETFNESVVGGPAINPSQFNPAVIQWDTGAGIGWITLYATEEALNAEVGPG
FT                   YLNLTYPRGTSASQFQFLVSPFETQKNVAGWQDIVGLNVTVSGNMDPTTLNISYSLSDQ
FT                   VIK"
     atgtcgcggt atctgagagc attcgtgctc gctctcgccg gatccaccct ggtggcatca        60
     gctagtacca gtactagcaa tagtaatagc tggtgccaga catcctggtc aacagataca       120
     tgccagctat tcacagagtc catggaatac cttgatagaa tatacgatgc ctccgcgggc       180
     tacgtctatg acccgagtgc tgcaacggcg ctgcgtcacg atacaaggac gtctgtgtgg       240
     tatgctgtgg ggttgttggc tcgggatcag ggcgatgatg tagctcaggc gatgactatc       300
     attcgaaacg tgatagatgc gcagttcaag gatacaagtg atcaatggta cggtgattac       360
     cagcagttcc ccgaagaacc tacagtggga acctcagctt acccacccat tatctatgat       420
     acctgggatc cgaattggag agagttcatt gggacggcct tcatcattgc gcttgaggag       480
     ttcccacatc tgatagatgc ggatatgacg cagctgatgc atgcgtcgct ttacaatgac       540
     actgttgggg atagttatcg ggtcggtggg gtggacgatg ataatctata tccgtcgtat       600
     acgaacccgt ccttaatgcg tgccatcatc acaggctgga cgggacgcaa gcttggagat       660
     cagaatatga ccaattcggg cgagacatac gcaacggaga tcatccggct cttcgatcgc       720
     gcagatacgc tttcggagtt taacagtgcc acttatacgg gtgtttctct gatcgcgctg       780
     actatgtggg ctaagtatgc tgcagaagac tcggtcatga aggggaaagg gaaggagatg       840
     ttgcaggata cttgggatac tatcggggaa ttgtatcatg ctgggttgaa aaaccttgct       900
     ggtccctggg atcgggctta tgggtttgat atgcaaaagt actttggtat catgtcgggg       960
     catatttggt cgctggtggg gaaagaaact tctcctgtta ttgataaggt gtatatgatg      1020
     tctcacaact ccgacttctc catctcgcct ctgatcgcta tcctgtcaaa ctttcacaat      1080
     tcgcttgtcc cgtcaacggc catccaagcc ctgaaaacct tccccggtga gcatatggtc      1140
     aacacatccg cgtactctat tccatatgac tccttcccac ggcaggtggc tgcgtggctg      1200
     agtgaaggca ttagcattgg agcggagacc ttcaatgagt ctgttgtagg tggcccagcc      1260
     atcaatccat cgcagtttaa cccggctgtc attcagtggg atactggagc tggaataggg      1320
     tggataacac tgtatgcgac ggaggaggct ctcaacgctg aagttggacc cggctatctg      1380
     aacctgacct atccgcgtgg gacgtcggcg tcccagtttc agttcctggt atctcctttt      1440
     gaaacccaga agaatgtggc tggctggcag gacattgtcg gcctgaatgt cactgtgtcg      1500
     gggaatatgg acccaacgac gctgaacatc tcgtatagct tgagcgacca agtcattaag      1560
     tag                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page