(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE204

ASPNC_1.PE204        Location/Qualifiers
FT   CDS_pept        join(523220..523457,523561..523787,523875..524159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000238441" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959925"
FT                   /orf_name="An01g02170"
FT                   /product="Similarity: similarity to S. pombe hypothetical
FT                   protein SPAC13C5. 04"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK43587.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG593654"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI0000EF9E7E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W4"
FT                   /transl_table=1
FT                   /translation="MPPLRIAILECDTPVEKVNNKYGGYRGVFSLLLRESAAALGQPDK
FT                   LDPETGLEFSGWDVVTAQEYPNLEDVDAIVLSGSKHDSFEDHPWILKLVEFTKKAFEDK
FT                   RVKIFAICFGHQILARALGARVGRNTAGWELAVCEVDLTETGKELFGRDKLRIHQMHQD
FT                   IAYGYPSEVISLGASPRCAVQGMYVPGKLISVQGHPEFREDIMTEILTLRTAAGIFSKE
FT                   QSEDAFNRAGIPHDGIAITMAFLKLLI"
     atgcccccgc ttcgtatcgc catccttgaa tgcgacaccc cagtcgaaaa agtaaacaac        60
     aaatatggag gctatcgcgg cgtattctca ctcctgctgc gtgaaagtgc tgcagcacta       120
     ggacaacccg ataagctaga cccagaaacc ggcctcgagt ttagcggctg ggacgtggta       180
     actgcgcaag agtaccccaa cctggaggat gtagacgcaa ttgttttgtc cgggtcaaaa       240
     cacgattcct ttgaggacca cccttggatc ctcaagctgg ttgaattcac caaaaaagct       300
     ttcgaagaca agcgcgttaa gattttcgct atttgcttcg gccatcagat cctggcacgt       360
     gcgcttggcg ccagagttgg tcgcaacact gcaggatggg aacttgcagt gtgtgaggtg       420
     gacttgactg agacggggaa ggagttgttc gggagggata agcttcgcat tcatcaaatg       480
     caccaggata ttgcgtacgg gtacccatcc gaggtcatct ccctgggcgc ttccccgagg       540
     tgtgcagtac agggcatgta tgtccctggg aagttgatct ctgtccaggg ccatccggaa       600
     ttcagagaag acatcatgac cgagatcctt actttgcgga ctgcggctgg tatcttctcg       660
     aaagaacaat cagaagatgc ctttaatcgc gcaggcatcc cacacgacgg cattgcgatt       720
     accatggcct tcttgaagct tctgatttga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page