(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE206

ASPNC_1.PE206        Location/Qualifiers
FT   CDS_pept        join(525648..525688,525754..526681)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110818"
FT                   /orf_name="An01g02190"
FT                   /product="Catalytic activity: ATP + Thiamine  "
FT                   /EC_number="2.7.6.2"
FT                   /function="hydrolase activity"
FT                   /function="thiamine diphosphokinase activity"
FT                   /protein_id="CAK43589.1"
FT                   /db_xref="GO:0004788"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG738523"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI0000EF9E80"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W6"
FT                   /transl_table=1
FT                   /translation="MGKSNLELVIECDRFPYYQDGPASYIEHLKNYHVFKVAGCDAILG
FT                   YILNSTVERFDLPSEWWATDSDNRSVTLLAPADATPQQRSEIMAKTLSKAVELGTFDIL
FT                   KGWRNEMYPIYGPGGKFLLEMERSATPLFGVVSYGVHSTVYVEDENGLRIWVPRRSKTK
FT                   QTYPGMLDNSVAGGMSTTEHPFECLVREAMEEASLPEDVVRANATPAGCVTYTYVRSAK
FT                   AGGETDLVQPEVEYIFDVKVGADIIPKPCDTEVEEFNLFTIEETKKALANGEFKPNCAV
FT                   VLIDFFIRHGILTPENEPDYLEIIARMHRRLEFPTASHVTV"
     atgggcaagt caaatcttga gctggttatt gagtgcgata gatttccgta ctaccaagat        60
     ggccccgctt cttatattga gcacctgaag aattatcatg ttttcaaggt cgccggttgc       120
     gatgccattc tcggttatat cctgaactcg acagtagaga ggttcgactt gccctcggaa       180
     tggtgggcga ctgattccga caaccggagc gtcaccctcc tggctccggc tgacgcgact       240
     cctcaacagc gcagcgagat catggccaag acgttgagta aggcagtgga gttgggaaca       300
     tttgacattc tcaagggttg gcgcaatgaa atgtatccta tctatggacc cggcggtaaa       360
     tttctcctgg aaatggaacg atctgctacc ccgctgtttg gtgtcgtttc gtacggcgtg       420
     cactcgaccg tttacgtgga agacgagaat ggtctacgca tctgggttcc caggcgctcg       480
     aaaaccaagc agacataccc cggtatgctt gataactccg tggcgggtgg aatgagcacc       540
     acggagcacc cgtttgaatg ccttgttcgc gaggcgatgg aggaagcttc cctgccggag       600
     gacgttgtca gagctaatgc cactccagcg ggatgtgtca cgtacacgta tgtccggagt       660
     gcaaaggctg gaggcgaaac agacctggtg cagccggagg tcgagtatat tttcgatgtc       720
     aaggtcgggg cggatattat ccccaagcct tgcgacactg aagtcgagga gttcaatctt       780
     ttcactatcg aagagacgaa gaaggcactg gctaatgggg agttcaagcc caactgtgcc       840
     gttgtcttga ttgacttctt cattagacat ggtattttga caccagagaa cgagccggac       900
     taccttgaga tcatcgcacg gatgcatcgg cgcttggagt tcccgactgc atcacacgtg       960
     acggtataa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page