(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE207

ASPNC_1.PE207        Location/Qualifiers
FT   CDS_pept        join(complement(527094..527422),complement(526894..526999))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806673"
FT                   /orf_name="An01g02200"
FT                   /product="Catalytic activity: nucleoside triphosphate +
FT                   RNA(n) "
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="CAK43590.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG595341"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0000EF9E81"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7W7"
FT                   /transl_table=1
FT                   /translation="MSDPVLFEDTFTITTINSQKYDRVSRLSCNSTDTLSHFTLDVNSE
FT                   LYPCVVGESVNMALASTLSLDGKDDSGSKGWREVGMGEQTLANDYDYVCHGKVYRFEEG
FT                   SSQGNMAVFISFGGLLLYLEGPYKKLAPLRIDYVYLLLKK"
     atgtccgacc cggtactttt cgaagacacc ttcacaatca ccaccatcaa ctcccagaaa        60
     tatgaccgtg tttcgcgtct gagctgcaac tccactgata ccctctcgca cttcaccctc       120
     gatgtcaact ccgagcttta cccttgcgtc gttggcgagt ctgtgaacat ggctctggcc       180
     tcgacgcttt ctctggatgg caaggatgac tccggatcga agggctggag agaggttgga       240
     atgggcgagc agaccttggc caacgactac gattatgtct gccacggcaa ggtttaccgc       300
     ttcgaggagg gttcgagtca gggtaacatg gccgttttca tctctttcgg tggacttttg       360
     ctttacctcg aaggtcctta caagaagttg gcccccttga ggatcgacta cgtgtatctg       420
     ctcctgaaga aatag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page