(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE215

ASPNC_1.PE215        Location/Qualifiers
FT   CDS_pept        join(complement(548800..549324),complement(548297..548484),
FT                   complement(547679..548242),complement(547427..547621),
FT                   complement(547288..547371),complement(547069..547243))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654008"
FT                   /orf_name="An01g02280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43598.1"
FT                   /db_xref="UniParc:UPI0000EF9E89"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X5"
FT                   /transl_table=1
FT                   /translation="MCHTSLRFPLATTTLGACHSYLTVTLHTYNFLTHPPLARPVPPES
FT                   LFGFYLTFGSRWSFAFFLSSSPPRRQVVNLQFSTILAGDFVPLPACIPPPPPPPSPILS
FT                   QRHVPFPPAHTLHTLYFTSDISSTPGPQDLTAPQPIIRWICPQAVPIPCDPSCWVFHPS
FT                   HRLVGCPKPTVTRSTILPEKMSTQQDPNPSNEGKHDGLSKYVKRMKMALRRSSTVRTTT
FT                   PVMQKSREPEPSQAPAPQRIPQAPTVKATPDATVFTNWGAIQEEKARALFAKYGLTLEP
FT                   GEWRSPSDTTVQRVVRPIRMRVRRTCHRCQTTFGPNKVCVNCQHVRCKSCPHHPSTKTN
FT                   DHRDDTQAALQAIVAQKLHKPVPVQHKPKQPPLTLPSRTGGQDVIHHPTRQRVRRTCHQ
FT                   CSTVFAPDATECSTCQHIRCTMCPRDPPKLGKYPHGYPGDVDAPAEPPARTWKKPRQRV
FT                   RYTCHKCTTLYRSGERNCSNCGQEKGPETIRDPPRRDKPKPDPEIVRRVEERLAKVRIS
FT                   TGANGKSGFSNRLPKLRLFTYVLAPSYDKNSSSASFTLCSSRMPQGTGHATMVGGPSIV
FT                   "
     atgtgccaca cttcccttag attcccttta gctactacta ctttaggcgc ctgccactct        60
     tacttgactg ttactttaca tacatacaac ttccttaccc acccccctct cgctcgtccg       120
     gttcccccag aaagtctgtt cggcttctat ttgacgttcg gctcgcgctg gtcgtttgcc       180
     ttctttttat cttcctctcc tccccgtcgt caagtcgtga atcttcaatt ttccaccatc       240
     ttggccggtg actttgttcc gctcccagcg tgcattccac ctccaccacc accaccatcc       300
     cccatccttt cacaacgtca cgtcccattc cctcctgcac atactttaca caccttatac       360
     tttacatcgg acatctcatc cacgcccggt ccacaggatc tgaccgcccc tcagccaatc       420
     atccgctgga tttgccccca ggctgttcca attccctgcg acccttcctg ttgggttttt       480
     cacccatctc accgtcttgt cgggtgtccc aagcctacgg ttacgagatc gacgatacta       540
     ccggagaaaa tgtcgactca acaggatccc aacccttcca acgaaggcaa gcacgatggc       600
     ttgtccaaat acgttaagcg catgaagatg gctctgagga ggagctcaac tgtccggacc       660
     accacgccag tcatgcagaa atcaagagaa cctgagccaa gccaagctcc cgctccccaa       720
     cgtatcccgc aggctcctac cgtcaaagct acacccgacg cgaccgtttt caccaactgg       780
     ggcgccattc aagaagagaa ggcgcgggct ctatttgcga aatacggact gacccttgag       840
     cctggtgaat ggaggtcccc tagcgatacg accgtgcagc gtgttgtcag accgatccgt       900
     atgcgagtgc gccgtacctg ccatcgctgc cagaccacct tcggcccgaa caaagtttgt       960
     gtcaactgcc agcacgtccg ctgcaagagc tgccctcacc atccctccac caagaccaac      1020
     gaccaccgcg acgacaccca ggctgcactc caggccattg tcgcgcagaa attgcacaaa      1080
     cctgtccctg tgcagcacaa acccaagcaa cctcctctta cgctgccctc acgcaccggc      1140
     ggccaggatg tcatccacca cccgacccga caacgagtcc gccgtacatg tcatcagtgt      1200
     agtactgtgt tcgctccgga tgctacggaa tgcagtactt gccagcatat tcggtgcaca      1260
     atgtgccctc gcgacccacc taaactgggc aaatacccgc atggctatcc tggagatgtc      1320
     gatgctcccg cagaacctcc tgcacggacg tggaagaagc cgcggcagcg ggtacgctat      1380
     acatgccaca agtgtacaac gttgtaccga tcgggagaga gaaattgctc caattgtggc      1440
     caagagaagg ggcctgaaac aatacgagat ccacctcgca gagacaagcc gaaaccagac      1500
     cccgaaattg ttcgacgggt tgaagagcga ttggcaaaag tcaggatcag tactggcgca      1560
     aatggcaagt caggattttc aaaccggttg ccaaagctgc gtctgttcac ttacgtgctc      1620
     gcaccttctt acgacaagaa tagcagctca gcaagcttta ccctttgcag ctctcgaatg      1680
     ccacaaggca ctgggcatgc aacgatggtt ggcggaccta gcattgtttg a               1731
//

If you have problems or comments...

PBIL Back to PBIL home page