(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE216

ASPNC_1.PE216        Location/Qualifiers
FT   CDS_pept        join(551475..551616,551659..551717,551896..551958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876769"
FT                   /orf_name="An01g02290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43599.1"
FT                   /db_xref="UniParc:UPI0000EF9E8A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7X6"
FT                   /transl_table=1
FT                   /translation="MKQPKNLNLHRRRSRSEKYSPTGFEGSELGFLLHRFVGTSLEGWC
FT                   WVGTGTGQDTWHENGGGDDDGDILLRIDPPTQNSSSFQHRTE"
     atgaagcaac cgaagaacct taacttgcat cgccgacgga gtagatcgga gaaatattca        60
     cctaccgggt tcgaaggcag tgaacttggg tttttgctcc accggtttgt aggtacatcg       120
     ttggagggtt ggtgttgggt ggggactggg actggacagg acacatggca tgaaaatggt       180
     ggtggtgatg atgatggaga tatactactc agaatagatc ctcccaccca gaacagctca       240
     tcatttcaac atcgtaccga atag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page